BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f12r (790 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41538-6|AAG00007.2| 575|Caenorhabditis elegans Intermediate fi... 30 1.6 U58746-3|AAB00623.1| 188|Caenorhabditis elegans Hypothetical pr... 29 2.9 >U41538-6|AAG00007.2| 575|Caenorhabditis elegans Intermediate filament, d protein1, isoform a protein. Length = 575 Score = 30.3 bits (65), Expect = 1.6 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +3 Query: 87 STTYRYGNKYYLSCKDNMNKTIYHE 161 ++++ YG+ Y L+ +D NKT++H+ Sbjct: 424 TSSHHYGSSYSLNVRDTHNKTVHHD 448 >U58746-3|AAB00623.1| 188|Caenorhabditis elegans Hypothetical protein R05G6.5 protein. Length = 188 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +3 Query: 246 NILNLPVFYIIQNYVYEYSEILYINKQYFKANFV*VTKIFTHF 374 N+++ + I+ NY YEY +L K K NF + K HF Sbjct: 15 NLVDRIIVIILPNYFYEYESVL---KHITKENFGIIEKTVKHF 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,063,764 Number of Sequences: 27780 Number of extensions: 245189 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1914239236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -