BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f12f (540 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51687| Best HMM Match : EMP70 (HMM E-Value=0) 29 1.8 SB_13308| Best HMM Match : MFS_1 (HMM E-Value=0.0008) 27 9.8 >SB_51687| Best HMM Match : EMP70 (HMM E-Value=0) Length = 392 Score = 29.5 bits (63), Expect = 1.8 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = -3 Query: 178 VVHQILFDCRSYSWLAFAFYAQGLSCFDIVIFTLIFIHVQLIH--ARGKAMASLALV 14 +VH +F +WL AF G+ F +V+ L+F + ++ +RG + ++ L+ Sbjct: 186 LVHGDVFRPPQKAWLLTAFIGTGVQIFSMVVIILVFAMLGMLSPASRGSMVQAIILL 242 >SB_13308| Best HMM Match : MFS_1 (HMM E-Value=0.0008) Length = 700 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/55 (25%), Positives = 30/55 (54%) Frame = -3 Query: 175 VHQILFDCRSYSWLAFAFYAQGLSCFDIVIFTLIFIHVQLIHARGKAMASLALVV 11 ++ ++F ++++ L +F+A GLS V +T IF ++ + AM ++V Sbjct: 479 LYDVIFTFKTFTILVLSFFAGGLSA---VHYTFIFWYLTDLSPEDSAMVIAVVIV 530 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,974,956 Number of Sequences: 59808 Number of extensions: 126594 Number of successful extensions: 267 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 266 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -