BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f12f (540 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24170.1 68415.m02888 endomembrane protein 70, putative simil... 32 0.21 >At2g24170.1 68415.m02888 endomembrane protein 70, putative similar to MURA transposase of maize Mutator transposon Length = 637 Score = 32.3 bits (70), Expect = 0.21 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 2/87 (2%) Frame = -3 Query: 268 LVPVEVYYAQISNYEILCYYHDDLLAVEVAVVHQILFDCRSYSWLAFAFYAQGLSCFDIV 89 ++ + Y ISNY L + + L +VH +F + L + G+ CF ++ Sbjct: 294 MIMLRTLYRDISNYNQLESHEEALEETGWKLVHGDVFRPPTNPELLCVYAGTGVQCFGMI 353 Query: 88 IFTLIFIHVQLIHA--RGKAMASLALV 14 + T+IF + + RG M ++ L+ Sbjct: 354 LVTMIFACLGFLSPSNRGGLMTAMLLL 380 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,141,759 Number of Sequences: 28952 Number of extensions: 82072 Number of successful extensions: 214 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 214 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 214 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1003808112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -