BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f10r (579 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24920.1 68418.m02951 expressed protein ; expression supporte... 28 3.9 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 27 9.0 >At5g24920.1 68418.m02951 expressed protein ; expression supported by MPSS Length = 147 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 349 HPRMISFELAYLVCIALDRRAKNESTRSTSEHPRVEEPQAGQQQHQD 489 +P ++ +A +C+ K E S+H ++EE GQ Q D Sbjct: 77 NPTFLATPVAAKICLDCVNMEKKEGQNGESKHSKLEEHIFGQDQGSD 123 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 523 PRDHQPHRHLLHPGAAAGQPVAPLLGDV 440 P D+ PHR+ HP P P G+V Sbjct: 245 PNDNHPHRNDNHPQRPPSPPPPPSAGEV 272 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,083,064 Number of Sequences: 28952 Number of extensions: 172231 Number of successful extensions: 376 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -