BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f09f (623 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 27 1.7 SPBC16D10.08c |||heat shock protein Hsp104 |Schizosaccharomyces ... 27 2.2 SPAC1782.05 |||phosphotyrosyl phosphatase activator homolog|Schi... 25 6.7 SPAC22E12.01 ||SPAC890.09|triose phosphate transporter |Schizosa... 25 8.9 >SPAC17H9.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 27.5 bits (58), Expect = 1.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 510 LGGRTDSRTHKDSCQRRQN*PRHGRC 587 L G+T + H +SC R++ RHG C Sbjct: 49 LDGKTLEKQHCESCSIREDSSRHGIC 74 >SPBC16D10.08c |||heat shock protein Hsp104 |Schizosaccharomyces pombe|chr 2|||Manual Length = 905 Score = 27.1 bits (57), Expect = 2.2 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 455 KWTTLTLEIQRMPLISSTVGRTNRLKDT*RLLSAKTKLTP 574 K+T E+ R + +GR + ++ T R+LS +TK P Sbjct: 166 KFTVDLTELARNGQLDPVIGREDEIRRTIRVLSRRTKNNP 205 >SPAC1782.05 |||phosphotyrosyl phosphatase activator homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 352 Score = 25.4 bits (53), Expect = 6.7 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 570 VNFVFADRSLYVSLSL-FVRPTVDDISGILWISKVN 466 + +V+ L S+SL F P +DDIS + SKVN Sbjct: 240 LGYVYFLNKLKPSVSLRFHSPMIDDISAVKTWSKVN 275 >SPAC22E12.01 ||SPAC890.09|triose phosphate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 374 Score = 25.0 bits (52), Expect = 8.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 61 LVTLVCGTQAFYMFGHEFSRTRLGDAIDKTSLKILKE 171 +V LV GT AF+M EF + + + ILKE Sbjct: 279 VVILVPGTLAFFMVASEFGLIQKTSIVTLSVCGILKE 315 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,675,856 Number of Sequences: 5004 Number of extensions: 55039 Number of successful extensions: 141 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -