BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f06r (767 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical prote... 25 3.4 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 24 5.9 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 7.9 >AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical protein protein. Length = 195 Score = 24.6 bits (51), Expect = 3.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 113 PMSVCP*QIFWLLPWSY 163 P+ P IFW LPWS+ Sbjct: 20 PLLAAP--IFWFLPWSF 34 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 263 SKFELLSFCPIQQLKYQPSMSHDSCSRAHG 352 +K L + CP L Y +CS+A G Sbjct: 271 AKIALTNLCPAVALSYGGRKPSSTCSKASG 300 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 476 YCCRSGSAADTQAIADIVTYH 414 Y CRS A + I+TYH Sbjct: 550 YMCRSNPPAQSDHNGKIITYH 570 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 711,353 Number of Sequences: 2352 Number of extensions: 12794 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -