BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f06f (588 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 1.4 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 23 1.9 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/45 (24%), Positives = 19/45 (42%) Frame = -3 Query: 472 QQLKYQPSMSHDSCSRAHGISLRQFPLVVDLLIPSCGSSNDMLQY 338 Q + + MSH G + P ++ L+P+ S D+ Y Sbjct: 344 QAMLHHNPMSHHLKQEPSGFTSSNHPFSINRLLPTAESKADIKMY 388 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.0 bits (47), Expect = 1.9 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +1 Query: 133 LPEWMSAPHSTGTSI 177 +P W++ PHS G ++ Sbjct: 4 VPGWLTPPHSLGNTV 18 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,735 Number of Sequences: 336 Number of extensions: 2667 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -