BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f05r (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 23 2.6 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 8.0 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 182 AVIFENYM-YIIFMNIQKNIHFITLSILNICEI 87 +V+ +N M YII ++ N++FI + + +I Sbjct: 155 SVLIDNNMSYIIIVSFATNLYFIIIQLFGSMKI 187 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 746 PSIMAIGPVPAIENLLKVTK 687 P I VPA +NLLK T+ Sbjct: 278 PEITRTDLVPAFQNLLKDTE 297 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,494 Number of Sequences: 336 Number of extensions: 2588 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -