BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f05f (612 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.4 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 23 3.1 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 4.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 4.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 4.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 4.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 4.1 M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 22 5.4 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 5.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 7.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 7.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.5 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.5 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 193 AIVCSSVADVLRKTPPKVPNGVL 125 A+V SS + ++ PP PNGV+ Sbjct: 1188 ALVMSSESILVSWRPPSQPNGVI 1210 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -1 Query: 399 ERCSRSTGNQSRIVC*CRAPASLEEYQL*APRDVA 295 E+ R ++ + C CR S+EEY + P+++A Sbjct: 99 EKKFRKVITKAPLECMCRPCTSVEEYAI-IPQEIA 132 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 232 LRSTAWSWAKSSLHHKLTESTRHVTRRS 315 LRS + S+ ++S H E +RH R S Sbjct: 217 LRSRSRSFQRTSSCHSRYEDSRHEDRNS 244 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 232 LRSTAWSWAKSSLHHKLTESTRHVTRRS 315 LRS + S+ ++S H E +RH R S Sbjct: 217 LRSRSRSFQRTSSCHSRYEDSRHEDRNS 244 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 232 LRSTAWSWAKSSLHHKLTESTRHVTRRS 315 LRS + S+ ++S H E +RH R S Sbjct: 217 LRSRSRSFQRTSSCHSRYEDSRHEDRNS 244 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 232 LRSTAWSWAKSSLHHKLTESTRHVTRRS 315 LRS + S+ ++S H E +RH R S Sbjct: 217 LRSRSRSFQRTSSCHSRYEDSRHEDRNS 244 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 232 LRSTAWSWAKSSLHHKLTESTRHVTRRS 315 LRS + S+ ++S H E +RH R S Sbjct: 217 LRSRSRSFQRTSSCHSRYEDSRHEDRNS 244 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 287 NLHATSRGAQSWYSSREAGARHQQ 358 +LH T + W+ +R A A+ Q Sbjct: 45 SLHLTETQVKIWFQNRRAKAKRLQ 68 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 215 GRSVPGSGRQH 247 G S PG+GR+H Sbjct: 392 GSSTPGTGREH 402 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 232 LRSTAWSWAKSSLHHKLTESTRHVTRRS 315 LRS + S+ ++S H E RH R S Sbjct: 217 LRSRSRSFQRTSSCHSRYEDLRHEDRNS 244 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -3 Query: 31 DNSHTTDEN 5 D SHTTDEN Sbjct: 232 DYSHTTDEN 240 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 215 GRSVPGSGRQ 244 GR +PG+GRQ Sbjct: 371 GRQLPGTGRQ 380 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 215 GRSVPGSGRQ 244 GR +PG+GRQ Sbjct: 371 GRQLPGTGRQ 380 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 9.5 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 347 EHRLLLRNTSFERRVTWRVDSV 282 E RL +NT+FE ++ + D+V Sbjct: 457 EKRLTKQNTAFENQLQFVSDAV 478 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,203 Number of Sequences: 438 Number of extensions: 3554 Number of successful extensions: 15 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -