BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f04f (637 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0847 + 32411521-32411619,32411737-32411851,32412292-324123... 31 0.77 >01_06_0847 + 32411521-32411619,32411737-32411851,32412292-32412375, 32412430-32413478,32414690-32416371,32416477-32416586, 32417634-32418430,32418839-32418951,32419147-32419194, 32419425-32419652,32419732-32419829,32419967-32420019 Length = 1491 Score = 31.1 bits (67), Expect = 0.77 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 143 LCIIYFYLLSNNETCRPVCQHIVIDMVEGYDLNLYLISAPIDSL 274 LC++ Y+ SN P C H + D+V+ ++ + IS+ +D L Sbjct: 1195 LCLLSSYVQSNRPAVFPTCAHCLFDVVDSVSVDGF-ISSLLDEL 1237 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,325,866 Number of Sequences: 37544 Number of extensions: 259541 Number of successful extensions: 450 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -