BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f04f (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_27653| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 9.7 >SB_5030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -3 Query: 626 LILYLFLWQY-LIEVVICTRFYNTFISFLYKINKYCSIKYFSN 501 + +++ LW L E+++ Y+ F+S Y I+ +C + F N Sbjct: 35 VFMFVMLWTISLFELLVVLPIYHEFLSTWYLIHVFCGLFMFLN 77 >SB_27653| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 416 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = -3 Query: 635 SISLILYLFLWQYLIEVVICTRFYNTFISFLYKINKYCSIK---YFSNKAL 492 S+ L+LF+ QY +++ T Y+T I L++ ++ S + Y NKA+ Sbjct: 192 SVHYTLFLFVVQYAAPLLLITVLYSTLIKDLWQSSRTHSDRKRAYKENKAV 242 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,755,372 Number of Sequences: 59808 Number of extensions: 344125 Number of successful extensions: 711 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -