BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f04f (637 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038608-4|AAU05594.2| 310|Caenorhabditis elegans Serpentine re... 30 1.2 U64845-6|AAC48028.1| 556|Caenorhabditis elegans Hypothetical pr... 29 3.7 >AF038608-4|AAU05594.2| 310|Caenorhabditis elegans Serpentine receptor, class z protein37 protein. Length = 310 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 620 LYLFLWQYLIEVVICTRFYNTFISFLYKINKYC 522 +Y+F WQ ++ VV F FIS+LY YC Sbjct: 219 IYIF-WQSIVVVVFKIHFIKEFISYLYFDYVYC 250 >U64845-6|AAC48028.1| 556|Caenorhabditis elegans Hypothetical protein F45F2.5 protein. Length = 556 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 454 KFVMYYNFYSIVYKALLEKYFIEQYLFILYKN 549 K + Y+ + ++ A+ YF+ YLF+LY N Sbjct: 64 KMWLEYSIFCVLMYAVAVAYFLYLYLFVLYPN 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,739,981 Number of Sequences: 27780 Number of extensions: 277664 Number of successful extensions: 535 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 535 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -