BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f02r (622 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_27337| Best HMM Match : efhand (HMM E-Value=2.9e-21) 36 0.027 SB_19134| Best HMM Match : Rab5ip (HMM E-Value=0) 30 1.7 SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 30 1.7 SB_47415| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 37.1 bits (82), Expect = 0.011 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +1 Query: 511 NQFLYGIRETGLELXKSEAEELFSQFDTDXSGSIXLD 621 N+F G+R+ G+ L E + F FDTD SG+I D Sbjct: 62 NEFKKGLRDYGVMLEPKEVKRTFEAFDTDGSGTIDFD 98 >SB_27337| Best HMM Match : efhand (HMM E-Value=2.9e-21) Length = 172 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = +1 Query: 511 NQFLYGIRETGLELXKSEAEELFSQFDTDXSGSIXLD 621 ++F G+++ G +L E ++LF+QFD D SGS+ + Sbjct: 58 DEFRKGMQDFGTKLTDDEVKQLFAQFDKDGSGSLDFE 94 >SB_19134| Best HMM Match : Rab5ip (HMM E-Value=0) Length = 150 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 178 ALVPDSVKKELLQKIKTHL 122 ALVPD VK+ELLQ+I+ L Sbjct: 128 ALVPDEVKRELLQRIRQFL 146 >SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1038 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -1 Query: 277 DQVRMLCRDIVKENESGNITFDSLVTKVTPRARALVPDSVKKELLQKI 134 D++R RD K+ E+ ++ ++TK A+ KKE+LQ+I Sbjct: 141 DRLRRTYRDNAKDAENAQKRYEEVITKDKMNAKEWDKSKDKKEILQEI 188 >SB_47415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 147 YCRKLKPIYSHRKTNKDKILIXFVLC 70 +C + KPI+S+R+T K K+ V+C Sbjct: 129 HCHEFKPIHSNRRTRK-KLTTASVVC 153 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +3 Query: 135 IFCNNSFFTESGTSALARGVTFVTKESNVMFPLSFSFTMSRHSIL 269 + N +F +L++GVT T+E+N++ MS HS++ Sbjct: 621 VLVNQAFIDTIHEHSLSQGVTEPTRENNILDLTEVLNGMSNHSVV 665 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,806,946 Number of Sequences: 59808 Number of extensions: 246315 Number of successful extensions: 439 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 439 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -