BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f02f (595 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1826 - 40164306-40164355,40165019-40165095,40165796-401658... 48 7e-06 01_01_0066 - 513578-513730,513809-513920,514000-514163,514369-51... 28 4.9 03_06_0235 + 32539025-32539886,32540330-32540473,32540595-325407... 27 8.5 >01_06_1826 - 40164306-40164355,40165019-40165095,40165796-40165890, 40166028-40166099,40166200-40166287,40166481-40166557 Length = 152 Score = 47.6 bits (108), Expect = 7e-06 Identities = 19/59 (32%), Positives = 31/59 (52%) Frame = +1 Query: 268 QRLILSGDXXXXXXXXXXXXXXCGWRDQVRMLCRDIVKENESGNITFDSLVTKVTPRAR 444 +RL+ SG+ CGWRD+++ LCR ++ N+T D L+ +TP+ R Sbjct: 78 KRLVESGEKEKLMELLRERLVECGWRDEMKALCRAYARKKGRNNVTVDDLIHVITPKGR 136 >01_01_0066 - 513578-513730,513809-513920,514000-514163,514369-514521, 514598-514736,514823-514923,514995-515666,515953-516038, 516112-516777,516874-517128,517231-517358,518645-518799, 518880-519133,519186-519260,519324-519399,519511-519644, 519871-520153,520692-520850,520940-521038,521142-521310, 521423-521653,522002-522114,524179-524310,524389-524469, 525641-525763 Length = 1570 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 364 CRDIVKENESGNITFDSLVTKVTPRARALVPDSVKKELLQ 483 CR I+ T D L+ KV + +A+ D + +LLQ Sbjct: 1353 CRSIIGTQSYVLFTLDKLIYKVVKQLQAIATDEMDNKLLQ 1392 >03_06_0235 + 32539025-32539886,32540330-32540473,32540595-32540747, 32540871-32540986,32541254-32541421,32541534-32541758, 32541884-32542015 Length = 599 Score = 27.5 bits (58), Expect = 8.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 97 GIKETGLELNKSEAEXLFSQFDTDSSGSI 11 G+K+ G L +SE L D D+SG+I Sbjct: 462 GLKKVGANLQESEIYALMQAADVDNSGTI 490 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,194,498 Number of Sequences: 37544 Number of extensions: 198956 Number of successful extensions: 345 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -