BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10f02f (595 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27337| Best HMM Match : efhand (HMM E-Value=2.9e-21) 35 0.057 SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.075 SB_19134| Best HMM Match : Rab5ip (HMM E-Value=0) 30 1.6 SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 30 1.6 SB_26916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_47415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_27337| Best HMM Match : efhand (HMM E-Value=2.9e-21) Length = 172 Score = 34.7 bits (76), Expect = 0.057 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = -1 Query: 112 NQFLYGIKETGLELNKSEAEXLFSQFDTDSSGSI 11 ++F G+++ G +L E + LF+QFD D SGS+ Sbjct: 58 DEFRKGMQDFGTKLTDDEVKQLFAQFDKDGSGSL 91 >SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 34.3 bits (75), Expect = 0.075 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 112 NQFLYGIKETGLELNKSEAEXLFSQFDTDSSGSI 11 N+F G+++ G+ L E + F FDTD SG+I Sbjct: 62 NEFKKGLRDYGVMLEPKEVKRTFEAFDTDGSGTI 95 >SB_19134| Best HMM Match : Rab5ip (HMM E-Value=0) Length = 150 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = +1 Query: 445 ALVPDSVKKELLQKIKTHL 501 ALVPD VK+ELLQ+I+ L Sbjct: 128 ALVPDEVKRELLQRIRQFL 146 >SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1038 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +1 Query: 346 DQVRMLCRDIVKENESGNITFDSLVTKVTPRARALVPDSVKKELLQKI 489 D++R RD K+ E+ ++ ++TK A+ KKE+LQ+I Sbjct: 141 DRLRRTYRDNAKDAENAQKRYEEVITKDKMNAKEWDKSKDKKEILQEI 188 >SB_26916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1732 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 109 QFLYGIKETGLELNKSEAEXLFSQFDTDSSGSI 11 +F G+KETGL + K + + L D ++ G I Sbjct: 576 EFSKGLKETGLVMTKRQLDRLMEYIDINNDGEI 608 >SB_47415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 476 YCRKLKPIYSHRKTNKDKILIKFVLCYF 559 +C + KPI+S+R+T K K+ V+C F Sbjct: 129 HCHEFKPIHSNRRTRK-KLTTASVVCLF 155 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -3 Query: 488 IFCNNSFFTESGTSALARGVTFVTKESNVMFPLSFSFTMSRHSIL 354 + N +F +L++GVT T+E+N++ MS HS++ Sbjct: 621 VLVNQAFIDTIHEHSLSQGVTEPTRENNILDLTEVLNGMSNHSVV 665 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,771,858 Number of Sequences: 59808 Number of extensions: 249799 Number of successful extensions: 465 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -