BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e23f (586 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 4.2 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 23 5.5 AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 23 7.3 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 9.6 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 4.2 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 112 SADSSTTPALAASTHIANTTRS 47 +AD S++PA ++ TH T RS Sbjct: 236 TADPSSSPAYSSITHYEPTARS 257 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 23.4 bits (48), Expect = 5.5 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +3 Query: 321 DIVKKYFPLSFRLIMAGNYVKLIYRNYNLALKLGSTTNPSNER 449 ++V+ Y P LI GN V + + + L+ GS SNE+ Sbjct: 112 NLVEVYEPPPVVLIDTGNNVVEVNTDDQIVLEDGSVEGESNEQ 154 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 23.0 bits (47), Expect = 7.3 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 243 VVNNLIIDKRRNTMEYCYKLWVG-NGQDIVKKYFPL 347 ++N I+ + RN+ME+C G G +V++ P+ Sbjct: 85 LLNRKILQRLRNSMEHCMAGSGGLGGGAVVREALPI 120 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 22.6 bits (46), Expect = 9.6 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -1 Query: 139 RSWLEGLMLSADSSTTPALAASTHIANTTRSFILLG 32 R W+E + L + S T + S+H + I+ G Sbjct: 670 RQWMESVELQLNISKTEYILVSSHRSRQESQIIVEG 705 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,563 Number of Sequences: 2352 Number of extensions: 11397 Number of successful extensions: 22 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -