BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e22f (617 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33376| Best HMM Match : Peptidase_C13 (HMM E-Value=0.00035) 30 1.3 SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 29 2.3 SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_50367| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_25182| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_184| Best HMM Match : PAN (HMM E-Value=4.1e-09) 27 9.2 SB_35038| Best HMM Match : Ras (HMM E-Value=6.8e-13) 27 9.2 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_33376| Best HMM Match : Peptidase_C13 (HMM E-Value=0.00035) Length = 1008 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 Query: 380 DGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVY 514 D L L + HG DG L F D ++ TS +++ F +W+ + + Sbjct: 127 DCLLYILFSPGHGGDGFLKFQDAEEVTSVELADAFEQMWQKQRYH 171 >SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 588 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = +3 Query: 93 QIPTSLTTFWRSSFTIASSLPITTVRLKRASIYTRRRRAKSSQM 224 +IPTS R SFTI +P + VR R S +T RR +S++ Sbjct: 403 RIPTSRVRQTRLSFTIVRRIPTSRVRQTRLS-FTMIRRIPASRV 445 Score = 28.3 bits (60), Expect = 5.3 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 93 QIPTSLTTFWRSSFTIASSLPITTVRLKRASIYTRRRRAKSSQM 224 +IPTS R SFT+ +P + VR R S +T RR +S++ Sbjct: 146 RIPTSRVRQTRLSFTMVRRIPTSRVRQTRLS-FTMVRRIPTSRV 188 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 29.5 bits (63), Expect = 2.3 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 1/70 (1%) Frame = +3 Query: 153 PITTVRLKRASIYTR-RRRAKSSQM**TN*YETTR*TAWSTPINFGSRAPRTSSVIVSQL 329 P T + R+S T RRR +++Q+ T Y+ T T+ + SR T ++ VS Sbjct: 3951 PTTGISESRSSSVTSIRRRFENNQLEET--YKRTETTSLVMDVQERSRESTTLAIDVSPR 4008 Query: 330 SSDLSSPKTP 359 + ++SP+TP Sbjct: 4009 APSVTSPRTP 4018 >SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 28.7 bits (61), Expect = 4.0 Identities = 18/66 (27%), Positives = 33/66 (50%) Frame = -2 Query: 448 TVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETITDDVLGALEPKLIGV 269 TVA+ ++ I + + ++V + G D SE ++ T +VL ALE + + + Sbjct: 71 TVAKTGMILLCGEITSNAVVDYQSVVRQCIKDIGYDDSEKGFDYKTCNVLVALEQQSVDI 130 Query: 268 LHAVHL 251 H VH+ Sbjct: 131 AHGVHV 136 >SB_50367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1498 Score = 27.9 bits (59), Expect = 7.0 Identities = 23/97 (23%), Positives = 43/97 (44%) Frame = +2 Query: 119 LEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGS 298 L L N I A +A + L++E K ++++NVV + + + + A++ W Q Sbjct: 810 LNRLLRNEISNAQGPNAAGQKNFLFQEVK-DILSNVVQRNMVRESLQAKKDAFESWRQVI 868 Query: 299 KDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSND 409 + + C P + L + A+ L +D L D Sbjct: 869 EVALATC-PGDILLQDVKQAVILETLQDLLMKIAQED 904 >SB_25182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 233 KLIRNNKMNCMEYAYQLWLQGSKDIVRDCF 322 +L NN+M +A+ WL+G + R C+ Sbjct: 17 RLHNNNRMLICTFAHSTWLKGRQGSSRQCY 46 >SB_184| Best HMM Match : PAN (HMM E-Value=4.1e-09) Length = 720 Score = 27.5 bits (58), Expect = 9.2 Identities = 20/66 (30%), Positives = 28/66 (42%) Frame = -3 Query: 384 PSRLYISLMAFSAKISLNSTGKQSRTMSLEPWSQS**AYSMQFILLFRISLFTTFVMTSL 205 P Y K+ + G S+ L W + A S+++ LL F T VM S Sbjct: 209 PKHAYFRQTEGKGKMFADCYGHSSKVNEL--WKKISPASSLEYELLLCNETFITGVMISK 266 Query: 204 FFSSYK 187 F +SYK Sbjct: 267 FHTSYK 272 >SB_35038| Best HMM Match : Ras (HMM E-Value=6.8e-13) Length = 322 Score = 27.5 bits (58), Expect = 9.2 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = +2 Query: 200 KKSEVITNVVNKLIRNNKMNCME------YAYQLWLQGSKDIVRD 316 KK + ++V L + NK N +E Q LQGSKDIVR+ Sbjct: 207 KKKKAAISLVESLFQENKPNPIEEECENFLKEQSGLQGSKDIVRN 251 >SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 27.5 bits (58), Expect = 9.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 149 RRCYCKAAPPEC 114 RRC+C+ APP C Sbjct: 203 RRCFCRYAPPRC 214 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,651,408 Number of Sequences: 59808 Number of extensions: 343453 Number of successful extensions: 4159 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4159 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -