BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e21r (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 33 0.17 SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 31 1.2 SB_13178| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_34358| Best HMM Match : DUF1280 (HMM E-Value=7) 30 2.1 SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) 30 2.1 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_1509| Best HMM Match : SRR (HMM E-Value=0.22) 30 2.1 SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_37888| Best HMM Match : Glycos_transf_4 (HMM E-Value=4.1) 28 8.4 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 33.5 bits (73), Expect = 0.17 Identities = 21/71 (29%), Positives = 38/71 (53%) Frame = -1 Query: 598 NAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSL 419 N V ++ PK ++ P S+ D WM+ +E FV+K+N Q+ + SS F K+ + Sbjct: 248 NESVLVWRAPKSSQDALPVSITDRWMSQHE---FVEKLNM-QAVLCASSHTDEFVKDFLI 303 Query: 418 PMAEIYKLLDQ 386 + +I L+ + Sbjct: 304 TLEKIPVLIHE 314 >SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) Length = 736 Score = 30.7 bits (66), Expect = 1.2 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 10/105 (9%) Frame = -1 Query: 511 ELDWFVQKVNPGQSQIT---RSSTDFAFFKEDSLPMA--EIYKL-LDQGKIPTDMFNSSD 350 E WF Q +N +S + R +T F D +P+ +I + +D+ +IPTD++ SS Sbjct: 404 EGQWFRQLINESESITSLCERINTFFCSLTSDFVPLTTDDILGIPVDESEIPTDLYVSSR 463 Query: 349 ----TMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVV 227 + S + G DG P + + + +E P +E + +++ Sbjct: 464 EAGIALQSIKLRKAGGPDGIP-NIILKTFSFELAPVIAEIYNALL 507 >SB_13178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = -1 Query: 358 SSDTMPSRLMLPKGTYDGFPFQLFV--FVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPV 185 +++T P+ +++P GT ++ + PY P P + P S GYP P Sbjct: 93 NTETSPNAVIIPPGTDPQLANLVYPPPSMAPYPPGPNQGTPPPSTQQQPGSGGYPMMYPQ 152 Query: 184 LPQYF 170 P Y+ Sbjct: 153 QPGYY 157 >SB_34358| Best HMM Match : DUF1280 (HMM E-Value=7) Length = 359 Score = 29.9 bits (64), Expect = 2.1 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 10/103 (9%) Frame = -1 Query: 511 ELDWFVQKVNPGQSQIT---RSSTDFAFFKEDSLPMA--EIYKL-LDQGKIPTDMFNSSD 350 E WF Q +N +S + R +T F D +P+ +I + +D+ +IPTD++ SS Sbjct: 255 EGQWFRQLINESESITSLCERINTFFCSLTSDFVPLTTDDILGIPVDESEIPTDLYVSSR 314 Query: 349 ----TMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKS 233 + S + G DG P + + + +E P +E + + Sbjct: 315 EAGIALQSIKLRKAGGPDGIP-NIILKTFSFELAPVIAEIYNA 356 >SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) Length = 867 Score = 29.9 bits (64), Expect = 2.1 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 10/103 (9%) Frame = -1 Query: 511 ELDWFVQKVNPGQSQIT---RSSTDFAFFKEDSLPMA--EIYKL-LDQGKIPTDMFNSSD 350 E WF Q +N +S + R +T F D +P+ +I + +D+ +IPTD++ SS Sbjct: 490 EGQWFRQLINESESITSLCERINTFFCSLTSDFVPLTTDDILGIPVDESEIPTDLYVSSR 549 Query: 349 ----TMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKS 233 + S + G DG P + + + +E P +E + + Sbjct: 550 EAGIALQSIKLRKAGGPDGIP-NIILKTFSFELAPVIAEIYNA 591 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -1 Query: 343 PSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYP 200 PS ++ P+ Y G+PFQ YP P P F + P + P YP Sbjct: 169 PSPVLSPQ-VYRGYPFQ-----YPGTPPPPMYPAFPPIFPSSPPPEYP 210 >SB_1509| Best HMM Match : SRR (HMM E-Value=0.22) Length = 644 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/76 (26%), Positives = 41/76 (53%) Frame = -2 Query: 228 FRTTNHSVIHSIAPFFLSTSNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIR 49 + T + V+++++ + + S N S + +T+ +NYS + +LT + +NY+ L Sbjct: 76 YLTLSIKVLNTLSKNYSTLSKNYLTLSIKVLNTLSKNYSTLSKNYLT---LSKNYSTL-- 130 Query: 48 KSKRTLTITVYNSRIS 1 SK LT++ S +S Sbjct: 131 -SKNYLTLSKNYSTLS 145 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/54 (22%), Positives = 34/54 (62%) Frame = -2 Query: 228 FRTTNHSVIHSIAPFFLSTSNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRN 67 + T + ++++++ +L+ S L + ++ ST+++NYS + +LT+ +I ++ Sbjct: 155 YLTLSIKLLNTLSKNYLTLSIKLLNTLSKNSSTLRKNYSTLSRNYLTLRRIPQH 208 >SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1894 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -1 Query: 274 PYEPTPKESEPFKSVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKV 140 P+ P + +PF+SV P +PF Q +QP+ F+ V Sbjct: 509 PFRPGQQPQQPFRSVQPPQQPFRADQQTQQPFQSGQQPHQPFRSV 553 >SB_37888| Best HMM Match : Glycos_transf_4 (HMM E-Value=4.1) Length = 355 Score = 27.9 bits (59), Expect = 8.4 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -2 Query: 210 SVIHSIAPFFLSTSNNLTCSSRRSWSTMKENYSPIYLTFLTIHQIKRNYNALIR-KSKRT 34 S+ AP L+T+NN TC+ R+ + PI + +L H K+ L + K T Sbjct: 19 SITTEDAPTSLATANNNTCNCRQK-NACPRKLPPI-ICYLPSHCNKKGQQHLRNLRKKAT 76 Query: 33 LTITVYN 13 T+ YN Sbjct: 77 ATMWHYN 83 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,091,205 Number of Sequences: 59808 Number of extensions: 405193 Number of successful extensions: 1130 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1126 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -