BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e18r (781 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 26 0.34 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.45 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 25 0.79 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 24 1.8 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 7.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 9.7 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 26.2 bits (55), Expect = 0.34 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -2 Query: 708 KELEEKLYNSIXTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDKSRNTMEYCYKL 538 +E E+++ ++I G YD+ +R S E G + N+ I TMEY +L Sbjct: 29 REKEKEVLDNIL-GGYDARIRPSGENATDGPAVVRVNIFVRSISKIDDVTMEYSVQL 84 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.8 bits (54), Expect = 0.45 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 759 VSAGVTEMSAGSMSSSNKELEEKLYNSIXTGDYDSA 652 V AG+ E SAG+ +S K+ + G YD + Sbjct: 1242 VGAGIAETSAGTSNSRGAAQMSKVPRDVSEGIYDGS 1277 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 25.0 bits (52), Expect = 0.79 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -2 Query: 708 KELEEKLYNSIXTGDYDSAVRQSLEYENQGKGSIIQNVVNNLIIDKSRNTMEYCYKL 538 +E E+++ ++I G YD+ +R S E G + N+ I S MEY +L Sbjct: 29 REKEKEVLDNIL-GGYDARIRPSGENATDGPAIVRVNLFVRSIATISDIKMEYSVQL 84 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 49 SYFTIVSKCHTVSRSVHNPTELQSIVVLAIVDEEQDVVFV 168 S T+V C S + T++ S+++ ++ QD+VF+ Sbjct: 124 SKLTLVLSCAMKFESYPHDTQICSMMIESLSHTTQDLVFI 163 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.8 bits (44), Expect = 7.4 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -1 Query: 235 PCYIRHQHRRHHQ 197 P Y H H HHQ Sbjct: 68 PIYQSHHHLHHHQ 80 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 9.7 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -1 Query: 220 HQHRRHHQGAVVPPAH 173 HQH H G + P H Sbjct: 336 HQHGNHTMGPTMGPPH 351 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,191 Number of Sequences: 438 Number of extensions: 4514 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -