BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e17f (585 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 1.7 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 1.7 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 23 2.2 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.4 bits (48), Expect = 1.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 Query: 314 TLRDAGPIVQIIPERRMYEDLESMSRPHICWSWEPT 207 +++ A IV I PER D E CWS EP+ Sbjct: 809 SVKKALMIVGIRPERLPSFDDECWRLMEQCWSGEPS 844 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.4 bits (48), Expect = 1.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 Query: 314 TLRDAGPIVQIIPERRMYEDLESMSRPHICWSWEPT 207 +++ A IV I PER D E CWS EP+ Sbjct: 847 SVKKALMIVGIRPERLPSFDDECWRLMEQCWSGEPS 882 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 154 IHDGEIEAGAVEKPTVANVGSQLQHMCGLDI 246 + GE+ G + K T+ L H+C L++ Sbjct: 91 VEHGELVMGILCKKTLGTSAGSLLHICMLEL 121 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.315 0.131 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,076 Number of Sequences: 438 Number of extensions: 3248 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -