BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e15r (766 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 24 1.8 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 24 1.8 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 5.4 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.5 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 669 TNTEHGNKGKLKGKSRPTSSNKKETEWK 586 ++T G +G+LKG P + KET+ K Sbjct: 136 SSTLSGLEGELKGTFYPLTGMSKETQQK 163 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 669 TNTEHGNKGKLKGKSRPTSSNKKETEWK 586 ++T G +G+LKG P + KET+ K Sbjct: 152 SSTLSGLEGELKGTFYPLTGMSKETQQK 179 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 22.2 bits (45), Expect = 5.4 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = -2 Query: 141 NFTSDNTDSEQQAISSMLLSWYMSGYYTGLYQGMKRSKENNKNGN 7 N +DN +++ Q ++ + G Q R +N +NGN Sbjct: 429 NQNADNQNADNQNANNQNADNQNANKQNGNRQNDNRQNDNKQNGN 473 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +1 Query: 340 HSIKIRRLTSKAIVTIILQRFFYLTGPLLISQTW 441 H+ K+R +T+ IV++ + L S TW Sbjct: 92 HTSKLRNVTNMFIVSLAVADLMVGLAVLPFSATW 125 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,844 Number of Sequences: 438 Number of extensions: 3822 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -