BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e15f (634 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 24 1.4 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 24 1.4 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.5 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.9 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 246 TNTEHGNKGKLKGKSRPTSSNKKETEWK 329 ++T G +G+LKG P + KET+ K Sbjct: 136 SSTLSGLEGELKGTFYPLTGMSKETQQK 163 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 246 TNTEHGNKGKLKGKSRPTSSNKKETEWK 329 ++T G +G+LKG P + KET+ K Sbjct: 152 SSTLSGLEGELKGTFYPLTGMSKETQQK 179 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 575 HSIKIRRLTSKAIVTIILQRFFYLTGPLLISQTW 474 H+ K+R +T+ IV++ + L S TW Sbjct: 92 HTSKLRNVTNMFIVSLAVADLMVGLAVLPFSATW 125 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 471 LARLMALTLNFHNLKI 424 LAR++AL ++ H L I Sbjct: 20 LARMLALLVSLHRLSI 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,419 Number of Sequences: 438 Number of extensions: 2567 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -