BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e14f (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 27 0.66 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 8.1 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 26.6 bits (56), Expect = 0.66 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 4 VIKMLFQSRIITILDFLQEDVEKLSNICKLSIPQIL 111 ++K + I L F Q+DVEK NIC+ I ++L Sbjct: 443 ILKSMILDPRIKQLGF-QDDVEKFKNICESIISELL 477 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.0 bits (47), Expect = 8.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 462 HDYGMSSNGNHITIKNLTS 518 HD G++ NG+H + L S Sbjct: 407 HDSGITENGDHTELTELMS 425 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,606 Number of Sequences: 2352 Number of extensions: 13691 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -