BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e10r (621 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52299| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 >SB_52299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 150 PMFFLKAQTITVSVHDKSKDFIYN*AYWNVKFSFYLCKTG 269 P F KAQTI++ + + I +YW V FS L + G Sbjct: 182 PSFSFKAQTISICIFIEYNVNISAVSYWFVSFSLELLRDG 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,424,705 Number of Sequences: 59808 Number of extensions: 294293 Number of successful extensions: 345 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -