BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e10r (621 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06460.1 68416.m00748 GNS1/SUR4 membrane family protein simil... 28 4.3 >At3g06460.1 68416.m00748 GNS1/SUR4 membrane family protein similar to SP|P25358 Elongation of fatty acids protein 2 (GNS1 protein) (V-SNARE bypass mutant gene 2 protein) {Saccharomyces cerevisiae}; contains Pfam profile PF01151: GNS1/SUR4 family Length = 298 Score = 28.3 bits (60), Expect = 4.3 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = -2 Query: 296 HVQLYFTL-FACFTQIKTKFHI-PVGLVVNKILRFVMYG 186 HV + T+ C+ ++T+ + PVGLV+N + +MYG Sbjct: 151 HVYHHATVVILCYLWLRTRQSMFPVGLVLNSTVHVIMYG 189 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,313,170 Number of Sequences: 28952 Number of extensions: 199216 Number of successful extensions: 284 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 284 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -