BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fner10e10r
(621 letters)
Database: arabidopsis
28,952 sequences; 12,070,560 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
At3g06460.1 68416.m00748 GNS1/SUR4 membrane family protein simil... 28 4.3
>At3g06460.1 68416.m00748 GNS1/SUR4 membrane family protein similar
to SP|P25358 Elongation of fatty acids protein 2 (GNS1
protein) (V-SNARE bypass mutant gene 2 protein)
{Saccharomyces cerevisiae}; contains Pfam profile
PF01151: GNS1/SUR4 family
Length = 298
Score = 28.3 bits (60), Expect = 4.3
Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
Frame = -2
Query: 296 HVQLYFTL-FACFTQIKTKFHI-PVGLVVNKILRFVMYG 186
HV + T+ C+ ++T+ + PVGLV+N + +MYG
Sbjct: 151 HVYHHATVVILCYLWLRTRQSMFPVGLVLNSTVHVIMYG 189
Database: arabidopsis
Posted date: Oct 4, 2007 10:56 AM
Number of letters in database: 12,070,560
Number of sequences in database: 28,952
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,313,170
Number of Sequences: 28952
Number of extensions: 199216
Number of successful extensions: 284
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 283
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 284
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1255974912
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -