BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e10f (643 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F3.01 ||SPAC323.09|mannosyltransferase complex subunit |Sch... 26 4.0 SPAC3H5.08c |||WD repeat protein Wdr44 family|Schizosaccharomyce... 25 7.0 >SPAC2F3.01 ||SPAC323.09|mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 26.2 bits (55), Expect = 4.0 Identities = 11/19 (57%), Positives = 15/19 (78%), Gaps = 1/19 (5%) Frame = -3 Query: 143 YCRYLLTPRAP-RLNPAVL 90 +C+YLLTP P R+ PA+L Sbjct: 226 FCKYLLTPHEPVRVLPALL 244 >SPAC3H5.08c |||WD repeat protein Wdr44 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 855 Score = 25.4 bits (53), Expect = 7.0 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -1 Query: 454 AQTITVSVHDKSKDFIYN*AYWNVKFS---FYLCKTGKQREVKLYMVL 320 + T+ V++ S N A W +KFS YL G+ R ++++ VL Sbjct: 221 SDTLAVAITSNSSSNSSNNAIWAMKFSRDGRYLAVGGQDRILRIWAVL 268 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,314,763 Number of Sequences: 5004 Number of extensions: 40890 Number of successful extensions: 59 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -