Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fner10e10f
         (643 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g06460.1 68416.m00748 GNS1/SUR4 membrane family protein simil...    28   4.6  

>At3g06460.1 68416.m00748 GNS1/SUR4 membrane family protein similar
           to SP|P25358 Elongation of fatty acids protein 2 (GNS1
           protein) (V-SNARE bypass mutant gene 2 protein)
           {Saccharomyces cerevisiae}; contains Pfam profile
           PF01151: GNS1/SUR4 family
          Length = 298

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 2/39 (5%)
 Frame = +2

Query: 326 HVQLYFTL-FACFTQIKTKFHI-PVGLVVNKILRFVMYG 436
           HV  + T+   C+  ++T+  + PVGLV+N  +  +MYG
Sbjct: 151 HVYHHATVVILCYLWLRTRQSMFPVGLVLNSTVHVIMYG 189


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,853,439
Number of Sequences: 28952
Number of extensions: 205581
Number of successful extensions: 305
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 303
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 305
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1324661040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)