BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e07f (622 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11820.1 68414.m01358 glycosyl hydrolase family 17 protein si... 29 1.9 At1g10000.1 68414.m01128 expressed protein 29 2.5 At5g22770.3 68418.m02661 adaptin family protein similar to SP|P1... 28 4.3 At5g22770.2 68418.m02660 adaptin family protein similar to SP|P1... 28 4.3 At5g22770.1 68418.m02659 adaptin family protein similar to SP|P1... 28 4.3 At1g72970.1 68414.m08439 glucose-methanol-choline (GMC) oxidored... 28 4.3 At1g49810.1 68414.m05585 sodium hydrogen antiporter, putative si... 28 4.3 At1g05630.1 68414.m00584 endonuclease/exonuclease/phosphatase fa... 28 4.3 At5g19980.1 68418.m02378 integral membrane family protein contai... 27 7.6 At3g60240.1 68416.m06732 MIF4G domain-containing protein / MA3 d... 27 7.6 At1g33250.1 68414.m04110 fringe-related protein + weak similarit... 27 7.6 >At1g11820.1 68414.m01358 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 511 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 397 AIGSLDLSLSGKVGLRAIIYYMTTTVCAVMLGIALVTTI 513 AIGS + + + +G + YY T + A+ +G ++TT+ Sbjct: 104 AIGSSNSTAASWIGRNVVAYYPETLITAISVGDEVLTTV 142 >At1g10000.1 68414.m01128 expressed protein Length = 303 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 346 RMLKSLIVPLLVSSIVSAIGSLDLSLSGKVGL 441 R + +P LV+SI A L L +SG +GL Sbjct: 264 RSISFQFIPRLVNSIADAAAKLSLCISGNIGL 295 >At5g22770.3 68418.m02661 adaptin family protein similar to SP|P18484 adaptor-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) {Rattus norvegicus}; contains Pfam profiles PF01602 Adaptin N terminal region, PF02883 Adaptin C-terminal domain Length = 1012 Score = 28.3 bits (60), Expect = 4.3 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = -3 Query: 452 MMARRPTFPERLRSREPIAETIEETS-KGTIKLLSILRKSSPGNWKYMTSRLDH*CPDAR 276 ++A P FPER S AE +E+T+ + IKL + + P N + + P Sbjct: 587 VLAEMPKFPERQSSLIKKAENVEDTADQSAIKLRA---QQQPSNAMVLADQQ----PVNG 639 Query: 275 RPHPSKVPAATPTT 234 P P KVP + +T Sbjct: 640 APPPLKVPILSGST 653 >At5g22770.2 68418.m02660 adaptin family protein similar to SP|P18484 adaptor-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) {Rattus norvegicus}; contains Pfam profiles PF01602 Adaptin N terminal region, PF02883 Adaptin C-terminal domain Length = 1012 Score = 28.3 bits (60), Expect = 4.3 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = -3 Query: 452 MMARRPTFPERLRSREPIAETIEETS-KGTIKLLSILRKSSPGNWKYMTSRLDH*CPDAR 276 ++A P FPER S AE +E+T+ + IKL + + P N + + P Sbjct: 587 VLAEMPKFPERQSSLIKKAENVEDTADQSAIKLRA---QQQPSNAMVLADQQ----PVNG 639 Query: 275 RPHPSKVPAATPTT 234 P P KVP + +T Sbjct: 640 APPPLKVPILSGST 653 >At5g22770.1 68418.m02659 adaptin family protein similar to SP|P18484 adaptor-related protein complex 2 alpha 2 subunit (Alpha-adaptin C) (Clathrin assembly protein complex 2 alpha-C large chain) {Rattus norvegicus}; contains Pfam profiles PF01602 Adaptin N terminal region, PF02883 Adaptin C-terminal domain Length = 1012 Score = 28.3 bits (60), Expect = 4.3 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = -3 Query: 452 MMARRPTFPERLRSREPIAETIEETS-KGTIKLLSILRKSSPGNWKYMTSRLDH*CPDAR 276 ++A P FPER S AE +E+T+ + IKL + + P N + + P Sbjct: 587 VLAEMPKFPERQSSLIKKAENVEDTADQSAIKLRA---QQQPSNAMVLADQQ----PVNG 639 Query: 275 RPHPSKVPAATPTT 234 P P KVP + +T Sbjct: 640 APPPLKVPILSGST 653 >At1g72970.1 68414.m08439 glucose-methanol-choline (GMC) oxidoreductase family protein similar to mandelonitrile lyase from Prunus serotina [SP|P52706, SP|P52707]; contains Pfam profile PF00732 GMC oxidoreductase Length = 594 Score = 28.3 bits (60), Expect = 4.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 6 RSRQPEQTDACVSRSKYKIESNDNSDAVLNAL 101 + R+PE T A ++R+KY++ N +L L Sbjct: 397 KQRRPEATQAYITRNKYQLHEAFNGSFILEKL 428 >At1g49810.1 68414.m05585 sodium hydrogen antiporter, putative similar to NhaD [Vibrio parahaemolyticus] gi|3123728|dbj|BAA25994; Na+/H+ aniporter (NhaD) family member, PMID:11500563 Length = 420 Score = 28.3 bits (60), Expect = 4.3 Identities = 19/75 (25%), Positives = 31/75 (41%) Frame = +1 Query: 196 PKFIRENLLTILTVVGVAAGTLLGCGLRASGHQWSKRDVMYFQFPGELFLRMLKSLIVPL 375 P R+ L ++ + A G G + W + F LFL SL+VPL Sbjct: 129 PSEYRKLLGAVVVIAANAGGAWTPIGDVTTTMLWIHGHISTFSTIKNLFLPSAISLVVPL 188 Query: 376 LVSSIVSAIGSLDLS 420 + S+ S + + L+ Sbjct: 189 ALMSLTSEVHGMGLN 203 >At1g05630.1 68414.m00584 endonuclease/exonuclease/phosphatase family protein similar to inositol 1,4,5-trisphosphate 5-phosphatase (GI:4688596) [Arabidopsis thaliana] Length = 861 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +3 Query: 249 GRNLAGMWPAGIRTSVVQTRRHVLPISRGAFPQDAQEFDSAFAGLLNRFSYRLSG 413 G+NL+ AG+ TS T+ + +P S GA + + F+YRL G Sbjct: 743 GQNLSNAAAAGVSTSAYTTKSNTIP-STGAEEIKSDLAAADMVAFFGDFNYRLFG 796 >At5g19980.1 68418.m02378 integral membrane family protein contains Pfam profile: PF00892 Integral membrane protein; similar to LPG2 protein (GI:9998817) [Leishmania mexicana] Length = 341 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 376 LVSSIVSAIGSLDLSLSGKVGLRAIIYYMTTTVCAVMLG 492 L SS+++ I L ++ GL + Y+T TV +LG Sbjct: 23 LCSSLLAVINKLAITYFNYPGLLTALQYLTCTVAVYLLG 61 >At3g60240.1 68416.m06732 MIF4G domain-containing protein / MA3 domain-containing protein similar to eukaryotic protein synthesis initiation factor [Homo sapiens] GI:3941724; contains Pfam profiles PF02854: MIF4G domain, PF02847: MA3 domain Length = 1544 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -2 Query: 366 YQTLEHPEEKLPGKLEVHDVSFGPLMSGCPQA 271 Y + PEEK VHDVS L+ PQA Sbjct: 650 YMAYKGPEEKKESSNVVHDVSNQNLLPAIPQA 681 >At1g33250.1 68414.m04110 fringe-related protein + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 548 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 384 LNRFSYRLSGPKPLWEGRSPRHHLLYDHDSLRGHV 488 +N + ++G LWE R L + +RGHV Sbjct: 131 MNHLMFGIAGSSQLWERRKELVRLWWKPSQMRGHV 165 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,091,078 Number of Sequences: 28952 Number of extensions: 307710 Number of successful extensions: 861 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 861 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1255974912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -