BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e06f (535 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0650 + 5500662-5501206,5502485-5502563,5503100-5503308,550... 27 9.5 04_01_0260 - 3506672-3508981 27 9.5 >12_01_0650 + 5500662-5501206,5502485-5502563,5503100-5503308, 5504396-5505146 Length = 527 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 193 YLNGSENVNRELLKADQELLNFKTPLQFIMHYCEFR 86 Y+NGSE V R L +N P++ I +C+F+ Sbjct: 454 YVNGSERVKRTLCHLSVVGIN-SFPVEAIKSFCQFK 488 >04_01_0260 - 3506672-3508981 Length = 769 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 404 LTHLAFCVGSWQNISFIILQSSVYRYVKKSN 312 L H C G W+ + IL +++R++ SN Sbjct: 344 LHHALLCSGKWRMLRRFILSLNLFRFLVNSN 374 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,444,210 Number of Sequences: 37544 Number of extensions: 132051 Number of successful extensions: 236 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 236 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 236 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1190246000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -