BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e06f (535 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles ... 25 1.6 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 8.5 >U50471-1|AAA93474.1| 135|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S8 mRNA, complete cds. ). Length = 135 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +3 Query: 291 FEELFPQITLFDISIDTGLQDNEGNILPRPYTKSQMRKWLKKVK 422 F + + L + L+ E ++L + TKS +RK++K+ K Sbjct: 38 FRQWYESHYLLPLGKKRELKAGEEDVLSKKRTKSNLRKYVKRQK 81 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 22.6 bits (46), Expect = 8.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 106 MHYCEFRGSLTNH 68 +HYC++RG+ H Sbjct: 810 LHYCDYRGNTPLH 822 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 416,808 Number of Sequences: 2352 Number of extensions: 5844 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -