BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e05r (432 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0316 - 7408003-7409340 27 4.9 04_03_0899 + 20662671-20662818,20663655-20663959,20664080-206642... 27 6.5 08_02_1421 - 26961716-26963650,26967316-26967942,26969832-26970887 27 8.6 01_01_0399 + 3036716-3037576 27 8.6 >03_02_0316 - 7408003-7409340 Length = 445 Score = 27.5 bits (58), Expect = 4.9 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 392 KASTLKKMMDKHAALGEFIFDKKLLGLN 309 KA+ L KM++KH LGE + GLN Sbjct: 415 KATELLKMLNKHKGLGECVDAVDFRGLN 442 >04_03_0899 + 20662671-20662818,20663655-20663959,20664080-20664265, 20665200-20665274,20665596-20665652 Length = 256 Score = 27.1 bits (57), Expect = 6.5 Identities = 12/54 (22%), Positives = 24/54 (44%) Frame = +1 Query: 250 GYISKRIRT*WRRYMQNIYTFNPRSFLSKMNSPRAACLSIIFLRVEALPARSRW 411 GYI +++ ++RYM+ + +F P + +I L++ S W Sbjct: 158 GYIEDAVKSAYKRYMKYLESFGPEENYLRKKVENELGTKMIHLKMRCSGVGSEW 211 >08_02_1421 - 26961716-26963650,26967316-26967942,26969832-26970887 Length = 1205 Score = 26.6 bits (56), Expect = 8.6 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -1 Query: 240 IWRKIVLCNNQSIIIFSFKQIKMYKL*CF 154 +WRK L +++SII ++ +KM K C+ Sbjct: 188 VWRKNGLLDDKSIIRRAYDDLKMRKFECY 216 >01_01_0399 + 3036716-3037576 Length = 286 Score = 26.6 bits (56), Expect = 8.6 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = +1 Query: 280 WRRYMQNIYTFNPRSF-----LSKMNSPRAACLSIIFLRVEALPARSRWP 414 W+R+ ++ F PR+ LS S AA + LR P R+ WP Sbjct: 191 WQRWWEHHDAFVPRAHDALLRLSSATSASAAAEDFLRLRSALSPGRNDWP 240 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,921,850 Number of Sequences: 37544 Number of extensions: 185301 Number of successful extensions: 378 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 378 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 814473264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -