BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e05r (432 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 2.7 AY341178-1|AAR13742.1| 230|Anopheles gambiae ferredoxin reducta... 22 8.1 AY341177-1|AAR13741.1| 230|Anopheles gambiae ferredoxin reducta... 22 8.1 AY341176-1|AAR13740.1| 230|Anopheles gambiae ferredoxin reducta... 22 8.1 AY341175-1|AAR13739.1| 230|Anopheles gambiae ferredoxin reducta... 22 8.1 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.8 bits (49), Expect = 2.7 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 417 QGPTRPRRQGLDPQEDDGQTRRPRRVHLRQETP 319 Q P + R Q PQ+ Q R+P + L + +P Sbjct: 471 QRPQQQRPQQQRPQQQRSQQRKPAKPELIEVSP 503 >AY341178-1|AAR13742.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 22.2 bits (45), Expect = 8.1 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 372 DDGQTRRPRRVHLRQETPRIERINILHVTPPLRSNPF 262 +DGQ L Q R+ +N++ PL++ PF Sbjct: 111 NDGQQATIGHYPLAQYHGRVAALNMIGKATPLKAVPF 147 >AY341177-1|AAR13741.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 22.2 bits (45), Expect = 8.1 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 372 DDGQTRRPRRVHLRQETPRIERINILHVTPPLRSNPF 262 +DGQ L Q R+ +N++ PL++ PF Sbjct: 111 NDGQQATIGHYPLAQYHGRVAALNMIGKATPLKAVPF 147 >AY341176-1|AAR13740.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 22.2 bits (45), Expect = 8.1 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 372 DDGQTRRPRRVHLRQETPRIERINILHVTPPLRSNPF 262 +DGQ L Q R+ +N++ PL++ PF Sbjct: 111 NDGQQATIGHYPLAQYHGRVAALNMIGKATPLKAVPF 147 >AY341175-1|AAR13739.1| 230|Anopheles gambiae ferredoxin reductase protein. Length = 230 Score = 22.2 bits (45), Expect = 8.1 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 372 DDGQTRRPRRVHLRQETPRIERINILHVTPPLRSNPF 262 +DGQ L Q R+ +N++ PL++ PF Sbjct: 111 NDGQQATIGHYPLAQYHGRVAALNMIGKATPLKAVPF 147 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 417,652 Number of Sequences: 2352 Number of extensions: 8338 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -