BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e05f (460 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006627-3|AAK85461.1| 504|Caenorhabditis elegans Hypothetical ... 27 6.6 Z82271-6|CAB05213.1| 1091|Caenorhabditis elegans Hypothetical pr... 27 8.7 Z73102-19|CAA97421.1| 1091|Caenorhabditis elegans Hypothetical p... 27 8.7 AF067607-12|AAF98615.2| 425|Caenorhabditis elegans Hypothetical... 27 8.7 AF003144-2|AAB54193.2| 217|Caenorhabditis elegans Hypothetical ... 27 8.7 >AC006627-3|AAK85461.1| 504|Caenorhabditis elegans Hypothetical protein E01A2.4 protein. Length = 504 Score = 27.1 bits (57), Expect = 6.6 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = +1 Query: 1 PRRTVQGPTRPRRQGLDPQEDDGQTRRPRRVHLRQETPRIERINILHVTPPLR 159 PRRT + P+ PRR+ + PRR R +P R PP + Sbjct: 108 PRRTRRSPSPPRRRRISRSPVRRSRSPPRRQVSRSRSPPPRRQQRSRSPPPAK 160 >Z82271-6|CAB05213.1| 1091|Caenorhabditis elegans Hypothetical protein F54E12.2 protein. Length = 1091 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 183 GYISKRIRT*WRR-YMQNIYTFNPRSFLSKMNSPRAACLSIIFLRV 49 G+I +R R + +QN + F PR + N + +C+ ++ LR+ Sbjct: 800 GFIPRRNRRAGKEGEVQNPFNFGPRDLAAGSNFEKMSCVLMLLLRL 845 >Z73102-19|CAA97421.1| 1091|Caenorhabditis elegans Hypothetical protein F54E12.2 protein. Length = 1091 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -2 Query: 183 GYISKRIRT*WRR-YMQNIYTFNPRSFLSKMNSPRAACLSIIFLRV 49 G+I +R R + +QN + F PR + N + +C+ ++ LR+ Sbjct: 800 GFIPRRNRRAGKEGEVQNPFNFGPRDLAAGSNFEKMSCVLMLLLRL 845 >AF067607-12|AAF98615.2| 425|Caenorhabditis elegans Hypothetical protein C18H7.1 protein. Length = 425 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 309 HRFFLIVYSSVNYKQIWRPW 368 HR LIVYS ++Y++ PW Sbjct: 71 HRVALIVYSGLSYRREVMPW 90 >AF003144-2|AAB54193.2| 217|Caenorhabditis elegans Hypothetical protein C55C2.3 protein. Length = 217 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 356 MASMARQIELVISVIN**CHIVFFFPLIIS 445 M S R +EL+ ++N CH + PL+++ Sbjct: 24 MHSSGRNLELIRDILNLYCHAKSYVPLVLN 53 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,766,113 Number of Sequences: 27780 Number of extensions: 205136 Number of successful extensions: 438 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 438 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 820565746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -