BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e03r (525 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein Vps1|Schizo... 26 3.0 SPAC9E9.10c |cbh1|cbh|centromere binding protein |Schizosaccharo... 25 9.1 >SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein Vps1|Schizosaccharomyces pombe|chr 1|||Manual Length = 678 Score = 26.2 bits (55), Expect = 3.0 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -3 Query: 295 IPVSVAVSDIIKYINEHEQEDCLLVGFSSQKVNPFREKSSCTV 167 +P S+++ +IKY EH Q + L + SQ + ++S TV Sbjct: 614 VPKSISLK-MIKYSKEHIQHELLEQLYKSQAFDKLLQESEVTV 655 >SPAC9E9.10c |cbh1|cbh|centromere binding protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 514 Score = 24.6 bits (51), Expect = 9.1 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -3 Query: 391 LSDTAVMDMMVSTLQQQRAVTEQLRR-EAAIKRIPVSVAVSDIIKYINEHEQED 233 L AV + L+++R +++ E I + ++A +IKY +HE D Sbjct: 440 LHQDAVDTVAAEFLEERRFESDEEEDVEPQISNVEAAMAFEVLIKYFEQHENGD 493 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,824,325 Number of Sequences: 5004 Number of extensions: 30536 Number of successful extensions: 59 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 214353836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -