BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e03r (525 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 29 1.9 At5g08720.1 68418.m01036 expressed protein 29 2.5 At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pf... 27 5.8 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = -3 Query: 373 MDMMVSTLQQQRAVTEQLRREAAIKRIPVSVAVSDIIKYINEHEQE 236 +D VS +Q++ V +++E A+K++P V SD +E E++ Sbjct: 31 IDTKVSLKKQKKDVIAAVQKEKAVKKVPKKVESSDDSDSESEEEEK 76 >At5g08720.1 68418.m01036 expressed protein Length = 719 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = -3 Query: 331 TEQLRREAAIKRIPVSVAVSDIIKYINEHEQE 236 T+Q RR ++R + V S+I+K+I+EH QE Sbjct: 521 TKQRRRIPGLQR-DIEVLKSEILKFISEHGQE 551 >At5g18525.1 68418.m02190 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 580 Score = 27.5 bits (58), Expect = 5.8 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 2/78 (2%) Frame = +3 Query: 234 SSCSCSLIYLMISETATDTGILFIAASLRSCSVTARCCCNVDTIISITAVSERPMLKTKA 413 +S SC Y E D GIL + SC T N T I+ SE P + +A Sbjct: 267 ASLSCVSSYHAHEEVVNDIGILSSTGKVASCDGTIH-VWNSQTGKLISLFSESPSDQDQA 325 Query: 414 KL--KD*NWASPCTRRES 461 N ++PC R S Sbjct: 326 SSDPSSKNNSNPCNRHAS 343 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,356,230 Number of Sequences: 28952 Number of extensions: 155643 Number of successful extensions: 295 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -