BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e03f (572 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 5.3 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 9.3 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 9.3 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 5.3 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -3 Query: 147 LCPRGLC*KQKQN*RTETGRRLALVVSHPRIL-FFLDNKLRFTENCQSQ 4 LC GL KQN + TG+R+AL+ +++ F + +K F + ++ Sbjct: 1494 LCNNGLL---KQNLYSPTGKRVALLSEDGQVVDFAMHSKTAFVASVNAR 1539 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 22.6 bits (46), Expect = 9.3 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 363 KGQYMNFFHGMDLLSDSKTQP 301 +GQ N HGM + + T P Sbjct: 387 RGQIWNTHHGMGMFGNQTTSP 407 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.6 bits (46), Expect = 9.3 Identities = 12/41 (29%), Positives = 15/41 (36%) Frame = +2 Query: 116 FCFQHRPLGHSRNGYDGINVTAAAGCN*AAPQRSSNKENPG 238 F +QH H NG G + S+K NPG Sbjct: 1396 FSYQHPHPHHHHNGSGRSKPPGPEGVGGGGGKSPSDKHNPG 1436 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 491,003 Number of Sequences: 2352 Number of extensions: 7569 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -