BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e02r (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 281 1e-77 EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519509-1|ABP73572.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519507-1|ABP73570.1| 250|Anopheles gambiae APL2 protein. 25 2.3 EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. 25 3.1 EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. 25 3.1 EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. 25 3.1 EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. 25 3.1 EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. 25 3.1 EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. 25 3.1 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 23 7.1 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 23 9.4 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 281 bits (690), Expect = 1e-77 Identities = 136/204 (66%), Positives = 153/204 (75%) Frame = -3 Query: 652 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQXXX 473 MGAYRY+QELYRKK SDVMR+LLRVR WQYRQ+TR HRAPRP RP + RRLGY+AK Sbjct: 1 MGAYRYVQELYRKKQSDVMRYLLRVRAWQYRQMTRFHRAPRPWRPTRLRRLGYKAKTGFS 60 Query: 472 XXXXXXXXXXXXXXXXXGATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXLSSYW 293 G TYGKPKSHGVNQLKP R LQS+AEE L+SYW Sbjct: 61 IFRIRVRCGGRKRPVHKGCTYGKPKSHGVNQLKPYRCLQSVAEERVGGRLGGLRVLNSYW 120 Query: 292 VAQDSSYKYFEVILVDPSHKAIRRDPKINWIVNAVHKHREMRGLTSAGRSSRGLGKGHRY 113 VAQD+++KYFEVI+VDP + AIRRDP +NWI NAVHKHRE+RGLTSAG+SSRGLGK +RY Sbjct: 121 VAQDAAHKYFEVIMVDPPNNAIRRDPNVNWICNAVHKHRELRGLTSAGKSSRGLGKAYRY 180 Query: 112 SQTKGGSRRAAWLRRNTLQLRRKR 41 SQT GGSRRAA +RRN L LRR R Sbjct: 181 SQTIGGSRRAAGVRRNRLHLRRYR 204 >EF519528-1|ABP73591.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519524-1|ABP73587.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519520-1|ABP73583.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519517-1|ABP73580.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519516-1|ABP73579.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519515-1|ABP73578.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519514-1|ABP73577.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519513-1|ABP73576.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519512-1|ABP73575.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519511-1|ABP73574.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519510-1|ABP73573.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519509-1|ABP73572.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519507-1|ABP73570.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTALNVSHNALKTFNVAQF 133 >EF519526-1|ABP73589.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF519523-1|ABP73586.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF519522-1|ABP73585.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF519521-1|ABP73584.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF519519-1|ABP73582.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 557 LTVLPYSHTQQKTHNIAQF 613 LT L SH KT N+AQF Sbjct: 115 LTXLNVSHNALKTFNVAQF 133 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 23.4 bits (48), Expect = 7.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 530 PGSAVHTSQLTVLPYSHTQQKTH 598 PGS +SQ + + H QQ+ H Sbjct: 14 PGSGASSSQRSPFHHHHQQQQNH 36 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 139 RGLGKGHRYSQTKGGSRR 86 +G+G GH Y + G RR Sbjct: 320 KGVGSGHLYYYEENGDRR 337 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 744,003 Number of Sequences: 2352 Number of extensions: 14205 Number of successful extensions: 62 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -