BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e02f (629 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) 242 2e-64 SB_13379| Best HMM Match : WD40 (HMM E-Value=1.3e-39) 30 1.8 SB_32922| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4) 29 3.1 SB_37342| Best HMM Match : NOSIC (HMM E-Value=5.4e-33) 29 3.1 SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) 29 4.1 SB_9981| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_41992| Best HMM Match : efhand (HMM E-Value=2.4e-10) 27 9.5 SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_46389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 242 bits (592), Expect = 2e-64 Identities = 113/192 (58%), Positives = 135/192 (70%) Frame = +3 Query: 54 MGAYRYIQELYRKKLSDVMRFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQXXX 233 MGAY+Y++ELY+KK SD++RFLLRVR WQYRQLT +HRA RPTRPDKARRLGY+AKQ Sbjct: 1 MGAYKYLEELYKKKQSDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGFV 60 Query: 234 XXXXXXXXXXXXXXXXXXATYGKPKSHGVNQLKPTRNLQSIAEEXXXXXXXXXXXXSSYW 413 ATYGKP + GVN+LK R+L+S+AEE +SYW Sbjct: 61 IYRVRVRRGGRKRPVPKGATYGKPVNQGVNELKFQRSLRSVAEERAGRYCGGLRVLNSYW 120 Query: 414 VAQDSSYKYFEVILVDPSHKAIRRDPKINWIVNAVHKHREMRGLTSAGRSSRGLGKGHRY 593 V QDS YKYFEVI+VDP HKAIRRD +INWI HKHRE+RGLT+AG +RG+ KGH Y Sbjct: 121 VGQDSIYKYFEVIMVDPFHKAIRRDARINWICKPTHKHRELRGLTAAGTKNRGMRKGHNY 180 Query: 594 SQTKGGSRRAAW 629 ++ G SRRA W Sbjct: 181 NKVIGSSRRANW 192 >SB_13379| Best HMM Match : WD40 (HMM E-Value=1.3e-39) Length = 574 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -3 Query: 204 VFGLC--PALWAWERGAYESTDGTAILSHATKNA*HRSVFSYTTPEYICRHPS 52 V+ +C AL A+ + STDGT I+ + + VF+ T E +C HPS Sbjct: 403 VYDVCLPKALPAYFQCVSASTDGTCIIWNLESFVRSQIVFANTMFEAVCYHPS 455 >SB_32922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 489 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -1 Query: 581 LAETSGAATSRSQTTHLTMLMYSIHDPVDLRIA 483 + ++SG AT +S L + + S DPVD+RIA Sbjct: 203 IRKSSGNATHQSHNCCLDLRLMSSEDPVDVRIA 235 >SB_3451| Best HMM Match : HOK_GEF (HMM E-Value=9.4) Length = 173 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 111 RFLLRVRVWQYRQLTRMHRAPRPTRPDKARRLGYRAKQ 224 +F ++ YR+ T+MH +RP + R G+R KQ Sbjct: 16 KFFVKRLTTPYRRRTQMHLLVSTSRPASSWRRGFRGKQ 53 >SB_37342| Best HMM Match : NOSIC (HMM E-Value=5.4e-33) Length = 300 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 516 VHKHREMRGLTSAGRSSRGLGKGHRYSQTK 605 +H + ++GLT A S LG GH YS+ K Sbjct: 61 MHFDKMIKGLTGAMASKAQLGLGHSYSRAK 90 >SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) Length = 1152 Score = 28.7 bits (61), Expect = 4.1 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 5/56 (8%) Frame = +2 Query: 101 RCYAFFVA---CESMA-VPSVDSYAPRSQAHKAGQSPKT-RLPC*TRLCCIQNPCA 253 RCY VA C ++ P +D+ A + P T ++PC C QNPC+ Sbjct: 702 RCYDINVAGINCRIISHPPKIDTTGGMQMAQQLSYPPYTGQVPCLPSSCTPQNPCS 757 >SB_9981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 27.9 bits (59), Expect = 7.2 Identities = 23/75 (30%), Positives = 32/75 (42%) Frame = -1 Query: 302 LAISGTLSNWTLAATTSHTDSEYNITLFSTVA*SSGFVRPCGPGSAVHTSQLTVLPYSHT 123 LA +GT LA T ++ +Y I ++ +R HT LT YSHT Sbjct: 709 LAYTGTYKYGILAYTGTY---KYGILAYTGTYTGYSHIRGLTNTGYSHTRGLTNTGYSHT 765 Query: 122 QQKTHNIAQFFPIQL 78 + T+N F I L Sbjct: 766 RGLTNNGRTLFSIVL 780 >SB_41992| Best HMM Match : efhand (HMM E-Value=2.4e-10) Length = 1303 Score = 27.5 bits (58), Expect = 9.5 Identities = 14/20 (70%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -3 Query: 582 PCRDLGSC-DQPKSDHASHD 526 PCRD GSC D P D ASHD Sbjct: 1162 PCRD-GSCRDAPFRDGASHD 1180 >SB_52883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 143 PSVDSYAPRSQAHKAGQSPKT-RLPC*TRLCCIQNPCA 253 P D+ AH+ P T ++PC C QNPC+ Sbjct: 239 PKTDANGGMQIAHQLPYPPYTGQIPCLPSSCAPQNPCS 276 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,123,516 Number of Sequences: 59808 Number of extensions: 459656 Number of successful extensions: 998 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -