BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e02f (629 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 26 0.35 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 26 0.35 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 26 0.35 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 3.2 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 5.7 X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 21 7.5 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 7.5 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 7.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 7.5 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 9.9 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.9 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 9.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.9 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.8 bits (54), Expect = 0.35 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 3 FYGLPVGHARRLPQAAKMGAYRY 71 F+GLPVG +P + YRY Sbjct: 262 FFGLPVGVTAAIPTSENPADYRY 284 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.8 bits (54), Expect = 0.35 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 3 FYGLPVGHARRLPQAAKMGAYRY 71 F+GLPVG +P + YRY Sbjct: 262 FFGLPVGVTAAIPTSENPADYRY 284 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.8 bits (54), Expect = 0.35 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 3 FYGLPVGHARRLPQAAKMGAYRY 71 F+GLPVG +P + YRY Sbjct: 262 FFGLPVGVTAAIPTSENPADYRY 284 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.6 bits (46), Expect = 3.2 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +1 Query: 7 TVYLWDTRDVCHRLLRW 57 T+Y +D RD C +W Sbjct: 402 TIYKYDVRDGCRTPFQW 418 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 5.7 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +1 Query: 34 VCHRLLRWVPTDI 72 VCH + W+PT + Sbjct: 807 VCHNGMNWMPTHL 819 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 21.4 bits (43), Expect = 7.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 543 LTSAGRSSRGLGKG 584 +T G+ +GLGKG Sbjct: 1 MTGRGKGGKGLGKG 14 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 7.5 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -3 Query: 204 VFGLCPALWAWERGAYESTD 145 + +C LW W R Y T+ Sbjct: 51 ILPVCNGLWRWIRLTYGQTN 70 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 7.5 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -3 Query: 204 VFGLCPALWAWERGAYESTD 145 + +C LW W R Y T+ Sbjct: 89 ILPVCNGLWRWIRLTYGQTN 108 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/34 (23%), Positives = 14/34 (41%) Frame = +2 Query: 107 YAFFVACESMAVPSVDSYAPRSQAHKAGQSPKTR 208 Y + ++ P+ P H+A + KTR Sbjct: 1213 YTVYTKADNAEEPTSQKVPPNQLTHEASELDKTR 1246 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 510 NAVHKHREMRGLTSAGRSSRGLGKGHR 590 N+ K+RE S R RG + HR Sbjct: 287 NSYRKYRETSKERSRDRRERGRSREHR 313 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/24 (33%), Positives = 15/24 (62%), Gaps = 4/24 (16%) Frame = +2 Query: 395 CVELLLG----CTRFFIQVFRGYP 454 C+ LL+G C +F + + +G+P Sbjct: 284 CMMLLIGHWSGCLQFLVPMLQGFP 307 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 9.9 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -3 Query: 198 GLCPALWAWERGAY 157 GLCP++ ++RG + Sbjct: 357 GLCPSMANYDRGVF 370 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/24 (33%), Positives = 15/24 (62%), Gaps = 4/24 (16%) Frame = +2 Query: 395 CVELLLG----CTRFFIQVFRGYP 454 C+ LL+G C +F + + +G+P Sbjct: 252 CMMLLIGHWSGCLQFLVPMLQGFP 275 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 9.9 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -3 Query: 198 GLCPALWAWERGAY 157 GLCP++ ++RG + Sbjct: 447 GLCPSMANYDRGVF 460 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,634 Number of Sequences: 438 Number of extensions: 3824 Number of successful extensions: 15 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -