BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10e01r (760 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22714| Best HMM Match : TPR_2 (HMM E-Value=1.2e-17) 29 5.4 SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) 28 9.5 >SB_22714| Best HMM Match : TPR_2 (HMM E-Value=1.2e-17) Length = 455 Score = 28.7 bits (61), Expect = 5.4 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = -2 Query: 756 QGDRGLP*SD-TSLAEAERIILKFVSNHVPEKICPLAGNSIYMDRMFLIKYMPKLNDYLH 580 +G+ G P + + AE + ++ F++ EKICP G +D L+K PK N L Sbjct: 185 KGESGQPPFEIVNKAENKAVLTSFINAIRSEKICP-EGRDECIDA--LVKVFPK-NKLLI 240 Query: 579 YRCIDVSTVKEL 544 +++ VKEL Sbjct: 241 LMFVNMKGVKEL 252 >SB_33744| Best HMM Match : SMC_N (HMM E-Value=0) Length = 1014 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 567 DVSTVKELAKRWYPREYSLIPQKKFEHRAL-NDILESVQEL 448 +V+ K L R Y++IP K HR + ND+++ ++L Sbjct: 378 EVTGKKLLQNGQLKRRYTIIPLNKISHRTIANDVVKRAEQL 418 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,659,611 Number of Sequences: 59808 Number of extensions: 414563 Number of successful extensions: 790 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2070332524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -