BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d22r (753 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB046775-1|BAB13381.2| 2414|Homo sapiens KIAA1555 protein protein. 31 5.9 >AB046775-1|BAB13381.2| 2414|Homo sapiens KIAA1555 protein protein. Length = 2414 Score = 30.7 bits (66), Expect = 5.9 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 5/79 (6%) Frame = -2 Query: 317 PFQLFVFVYPYEPTPKESEPFKSVVPDNKPFGYPFDRPVL-PQYFKQPNMFFKKVLVY-- 147 P LF F + + P +S F S + P+ P+L P F+ P + + +++ Sbjct: 1151 PVSLFSFQHLVQHEPGQSPEFFSTQAMSSLLSSPYSMPLLPPSLFQAPPLPLQPTVLHPG 1210 Query: 146 --HEGELFPYLFNIPHYTP 96 H +L P+ NIP P Sbjct: 1211 QLHLPQLMPHPANIPFRQP 1229 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,867,023 Number of Sequences: 237096 Number of extensions: 2092994 Number of successful extensions: 4422 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4422 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9071127468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -