BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d21r (660 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 2.8 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 2.8 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 3.7 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 24 3.7 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 23 6.5 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 6.5 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 6.5 Z69978-1|CAA93818.1| 268|Anopheles gambiae serine protease prot... 23 8.5 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 8.5 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 379 KPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 +PV+ LP Q PVP T +R + TP P Sbjct: 509 RPVYVALPLEQTTPVPTSTT--SRPLRTPFP 537 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 379 KPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 +PV+ LP Q PVP T +R + TP P Sbjct: 508 RPVYVALPLEQTTPVPTSTT--SRPLRTPFP 536 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 248 GQRKCNQTVQLQRCRKARLNI*RKYQG 168 GQ CN V+ +RC + + N ++QG Sbjct: 1003 GQCPCNDNVEGRRCDRCKENKYDRHQG 1029 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 24.2 bits (50), Expect = 3.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 374 RLRSYRR*SCHDRFDLSWRHGCRSRLDNRRLC 469 R R YR C +R L+ H CRS D ++LC Sbjct: 474 RQRCYR---CLERGHLA--HACRSSTDRQQLC 500 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 23.4 bits (48), Expect = 6.5 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 616 IIGIVLLLVFYGSECRKIY 560 ++ + LLLVFY ++C +Y Sbjct: 485 LVALKLLLVFYVNKCELMY 503 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.4 bits (48), Expect = 6.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +3 Query: 264 VTSCCTLPGPGVVMSRVAGVGYTGTGLI 347 ++S PGP V+ GVG G L+ Sbjct: 1096 ISSATPAPGPFVISGNGGGVGGAGAQLL 1123 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/24 (37%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 401 CHDRFDLS-WRHGCRSRLDNRRLC 469 C+ +L W H CRS D + +C Sbjct: 662 CYRCLELGHWAHDCRSPDDRQNMC 685 >Z69978-1|CAA93818.1| 268|Anopheles gambiae serine protease protein. Length = 268 Score = 23.0 bits (47), Expect = 8.5 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 568 KIYKPIDKNANIDFINMEAGGARPVGKPT 482 ++ KP N NI +++ A P G+ T Sbjct: 129 RVDKPFHLNRNIQLVSLPEPNAIPTGETT 157 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.0 bits (47), Expect = 8.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 520 MEAGGARPVGKPTD 479 + +GG PVG PTD Sbjct: 1015 LSSGGGPPVGTPTD 1028 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,654 Number of Sequences: 2352 Number of extensions: 12901 Number of successful extensions: 25 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -