BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d21r (660 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54930.1 68418.m06841 AT hook motif-containing protein contai... 33 0.17 At3g28790.1 68416.m03593 expressed protein 33 0.17 At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transfera... 33 0.17 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 33 0.22 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 33 0.22 At5g38560.1 68418.m04662 protein kinase family protein contains ... 31 0.51 At4g38080.1 68417.m05378 hydroxyproline-rich glycoprotein family... 31 0.68 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 31 0.68 At2g29740.1 68415.m03614 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.90 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 30 1.6 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 30 1.6 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 30 1.6 At1g07260.1 68414.m00772 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.6 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 29 2.1 At1g14710.2 68414.m01759 hydroxyproline-rich glycoprotein family... 29 2.1 At1g14710.1 68414.m01758 hydroxyproline-rich glycoprotein family... 29 2.1 At1g14430.1 68414.m01711 glyoxal oxidase-related low similarity ... 29 2.1 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 29 2.7 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 29 2.7 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 29 2.7 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 29 2.7 At1g26150.1 68414.m03192 protein kinase family protein similar t... 29 2.7 At5g61090.1 68418.m07665 proline-rich family protein contains pr... 29 3.6 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 29 3.6 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 29 3.6 At4g16280.1 68417.m02469 flowering time control protein / FCA ga... 29 3.6 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 29 3.6 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 28 4.8 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 28 4.8 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 28 4.8 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 28 4.8 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 28 4.8 At2g02490.1 68415.m00188 hydroxyproline-rich glycoprotein family... 28 4.8 At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein /... 28 4.8 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 28 6.3 At1g47660.1 68414.m05295 hypothetical protein 28 6.3 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 28 6.3 At5g65100.1 68418.m08189 ethylene insensitive 3 family protein c... 27 8.4 At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid t... 27 8.4 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 27 8.4 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 27 8.4 >At5g54930.1 68418.m06841 AT hook motif-containing protein contains Pfam profile PF02178: AT hook motif Length = 286 Score = 33.1 bits (72), Expect = 0.17 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 400 ALTPVAPKPVHPTLPPNQIKPVPVYP 323 AL PV +P HPT+P N I PV + P Sbjct: 150 ALVPVPIQPAHPTIPNNLIVPVVLQP 175 >At3g28790.1 68416.m03593 expressed protein Length = 608 Score = 33.1 bits (72), Expect = 0.17 Identities = 23/64 (35%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = -3 Query: 394 TPVAPKPVHPT-LPPNQIKPVPVYPTPATRLITTPGPGSVQQLVTFYNSQGKGSVIKPYS 218 TP P P PT P P P PTP+T +TP G + + S K S K S Sbjct: 282 TPSTPTPSTPTPSTPTPSTPTPSTPTPSTPAPSTPAAGKTSEKGSESASMKKESNSKSES 341 Query: 217 YSDA 206 S A Sbjct: 342 ESAA 345 >At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose glucosyltransferase GI:453245 from [Manihot esculenta] Length = 479 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +2 Query: 206 GIAVTVRFDYTSFALAIVESDELLHASRSW--GGDEPRR 316 G+AV +R DY S +V DE+ A RS GGDE R+ Sbjct: 404 GLAVDLRMDYVSSRGGLVTCDEIARAVRSLMDGGDEKRK 442 >At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 299 Score = 32.7 bits (71), Expect = 0.22 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = -3 Query: 391 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSVQQLVT 263 PVAP P P PP P P P AT +TTP P V ++ Sbjct: 117 PVAPAPTRP--PPPAPTPTPA-PVAATETVTTPIPEPVPATIS 156 >At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 419 Score = 32.7 bits (71), Expect = 0.22 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = -3 Query: 391 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSVQQLVT 263 PVAP P P PP P P P AT +TTP P V ++ Sbjct: 117 PVAPAPTRP--PPPAPTPTPA-PVAATETVTTPIPEPVPATIS 156 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 31.5 bits (68), Expect = 0.51 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 394 TPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGS 281 TP AP PV P P Q P V +P ++++P P S Sbjct: 31 TPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSS 68 >At4g38080.1 68417.m05378 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Common family member: At2g22510 [Arabidopsis thaliana] Length = 128 Score = 31.1 bits (67), Expect = 0.68 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -3 Query: 394 TPVAPKPV--HPTLPPNQIKPVPVYPTPATRLITTPGP 287 TPV P P LP + PVP PTP + + P P Sbjct: 35 TPVTQPPALTFPPLPKTTMPPVPSLPTPGQQTLPQPQP 72 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.1 bits (67), Expect = 0.68 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 403 TALTPVAPKPVHPTL-PPNQIKPVPVYPTPATRLITTPGP 287 T P P P P + PP PV PTP ++T P P Sbjct: 161 TPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTP 200 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -3 Query: 397 LTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 +TP P P T PP PV PTP +IT P P Sbjct: 185 ITPPTPTPPVVT-PPTPTPPVITPPTPTPPVITPPTP 220 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -3 Query: 397 LTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 +TP P P T PP PV PTP +IT P P Sbjct: 175 VTPPTPTPPVIT-PPTPTPPVVTPPTPTPPVITPPTP 210 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -3 Query: 397 LTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 +TP P P T PP PV PTP ++T P P Sbjct: 205 ITPPTPTPPVIT-PPTPTPPVVTPPTPTPPVVTPPTP 240 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 391 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 P PKP H PP P P PTP ++T P P Sbjct: 148 PSTPKPPHHKPPPTPCPP-PT-PTPTPPVVTPPTP 180 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -3 Query: 382 PKPVHPTL-PPNQIKPVPVYPTPATRLITTPGP 287 P P P + PP PV PTP ++T P P Sbjct: 198 PTPTPPVITPPTPTPPVITPPTPTPPVVTPPTP 230 >At2g29740.1 68415.m03614 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 474 Score = 30.7 bits (66), Expect = 0.90 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +2 Query: 206 GIAVTVRFDYTSFALAIVESDELLHASRSW--GGDEPRR 316 G+A+ +R DY S IV++DE+ A RS G D PRR Sbjct: 406 GLALEMRLDYVSEYGEIVKADEIAGAVRSLMDGEDVPRR 444 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 29.9 bits (64), Expect = 1.6 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = -3 Query: 400 ALTPVAPKPVHPTLPPNQIKPVPV-YPTPA--TRLITTPGPGSVQQLVTFYNSQGKGS 236 A TP PKP PP KP P PTPA + P PG + T ++ + KG+ Sbjct: 91 APTPPNPKPTPAPTPPKP-KPAPAPAPTPAPKPKPAPKPAPGGEVEDETEFSYETKGN 147 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 400 ALTPVAPKPVH-PTLPPNQIKPVPVYPTPATRLITTP 293 A TP PKP PT P + KP P P P TP Sbjct: 69 APTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTP 105 Score = 28.3 bits (60), Expect = 4.8 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 400 ALTPVAPKPVH-PTLPPNQIKPVPVYPTPATRLITTP 293 A TP PKP PT P + KP P P P TP Sbjct: 36 APTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTP 72 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 391 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSV 278 P P P LPP P V PTP++ +TP PG++ Sbjct: 589 PSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTPGTL 626 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 394 TPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 +P P P++ PP P PVY +P + +P P Sbjct: 542 SPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPP 577 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -3 Query: 394 TPVAPKPVHPTLPPNQIKPVPVY-PTPAT 311 +P P PV+ PP+ P PVY P P T Sbjct: 608 SPPPPSPVYSPPPPSHSPPPPVYSPPPPT 636 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 391 PVAPKPVH-PTLPPNQIKPVPVYPTPATRLITTPGPGS 281 P P PVH P PP P PV+ P + +P P S Sbjct: 585 PSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPS 622 >At1g07260.1 68414.m00772 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 476 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +2 Query: 206 GIAVTVRFDYTSFALAIVESDELLHASRSW--GGDEPRR 316 G+AV +R DY S IV+++E+ A RS G D PR+ Sbjct: 403 GLAVELRLDYVSAYGEIVKAEEIAGAIRSLMDGEDTPRK 441 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -3 Query: 382 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 P PVH PP P PVY P + +P P Sbjct: 596 PPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPP 627 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -3 Query: 382 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 P PVH PP P PVY P + + P P Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -3 Query: 382 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 P PVH PP P PVY P + + P P Sbjct: 633 PPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 >At1g14710.2 68414.m01759 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 601 Score = 29.5 bits (63), Expect = 2.1 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = -3 Query: 391 PVAPKPVHPTLPPN---QIKPVPVYPTPATRLITTPGPGSVQQLVTFYN-SQGK 242 P P PV P LPP+ Q P P P P T + PGS Q+L N ++GK Sbjct: 524 PTGP-PVWPLLPPHPRHQTAPQPRMPIPGTGVFLP--PGSNQELADNSNGTEGK 574 >At1g14710.1 68414.m01758 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 601 Score = 29.5 bits (63), Expect = 2.1 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = -3 Query: 391 PVAPKPVHPTLPPN---QIKPVPVYPTPATRLITTPGPGSVQQLVTFYN-SQGK 242 P P PV P LPP+ Q P P P P T + PGS Q+L N ++GK Sbjct: 524 PTGP-PVWPLLPPHPRHQTAPQPRMPIPGTGVFLP--PGSNQELADNSNGTEGK 574 >At1g14430.1 68414.m01711 glyoxal oxidase-related low similarity to glyoxal oxidase precursor (glx1) [Phanerochaete chrysosporium] GI:1050302 Length = 849 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -3 Query: 373 VHPTLPPNQIKPVPVY-PTPATRLITTPGPGSVQQLVTFYNSQGKGSVIKP 224 VH +P + + V PTP ++ P S L+ FYN G V+ P Sbjct: 551 VHRGIPSVAVWEISVKTPTPREKIFDFVCPSSCDGLICFYNLYKSGIVVNP 601 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 29.1 bits (62), Expect = 2.7 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 7/40 (17%) Frame = -3 Query: 391 PVAPKPVHPTLPPN-------QIKPVPVYPTPATRLITTP 293 P+ P PTLPPN + P+P+ PTP T L T P Sbjct: 276 PLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPT-LPTIP 314 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -3 Query: 394 TPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 TP P P P PP P P P+P + T P P Sbjct: 141 TPSVPSPTPPVSPPPPT-PTPSVPSPTPPVPTDPMP 175 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -3 Query: 394 TPVAPKPVHPT-LPPNQIKPVPVYPTPATRLITTPGPGSV 278 TP P P P P P PV P P T + P P V Sbjct: 159 TPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDV 198 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -3 Query: 394 TPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 TP P+ P PP Q+ P P P+P TP P Sbjct: 716 TPTYSPPIKP--PPVQVPPTPTTPSPPQGGYGTPPP 749 Score = 27.5 bits (58), Expect = 8.4 Identities = 24/65 (36%), Positives = 27/65 (41%), Gaps = 6/65 (9%) Frame = -3 Query: 391 PVAPKPVH----PTL-PPNQIKPVPVYPTPATRLITTPGPGSVQQLVTFYN-SQGKGSVI 230 PV P PV PT PP + PV V PTP P P V T + QG Sbjct: 688 PVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTP 747 Query: 229 KPYSY 215 PY+Y Sbjct: 748 PPYAY 752 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 391 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSV 278 PV P P P +PP Q VPV P P +I+ P ++ Sbjct: 155 PVMPPPQVPVMPPPQ---VPVKPHPKVPVISPDPPATL 189 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = -3 Query: 385 APKPVHP-TLPPNQIKPVPVYPT--PATRLITTPGP 287 AP P +P + PP + P P PT P T IT+P P Sbjct: 108 APPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSP 143 >At5g61090.1 68418.m07665 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; common family members: At4g18570, At3g25690, At4g04980 [Arabidopsis thaliana] Length = 344 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -3 Query: 394 TPVAPKPVHPTLPPNQI-KPVPVYPTPATRLITTPGP 287 TP AP+ V P P +I +PVP PTP T T P Sbjct: 100 TPEAPRSV-PACPIPEIPRPVPARPTPETPRPVTARP 135 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 382 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGS 281 PKP TLP NQ P+ Y P + PG S Sbjct: 363 PKPGQATLPSNQGGPLGGYGVPPLNPLPVPGVSS 396 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 382 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGS 281 PKP TLP NQ P+ Y P + PG S Sbjct: 363 PKPGQATLPSNQGGPLGGYGVPPLNPLPVPGVSS 396 >At4g16280.1 68417.m02469 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 505 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 382 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGS 281 PKP TLP NQ P+ Y P + PG S Sbjct: 121 PKPGQATLPSNQGGPLGGYGVPPLNPLPVPGVSS 154 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = -3 Query: 391 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSVQQLVTFYNS 251 P P P + PP+ + P P P P + T PG + + +Y + Sbjct: 67 PSPPPPKKSSCPPSPLPPPP--PPPPPNYVFTYPPGDLYPIENYYGA 111 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 391 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTP 293 P+ P P++ PP I P P+Y P T + P Sbjct: 79 PIYPPPIYSP-PPPPIYPPPIYSPPPTPISPPP 110 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -3 Query: 391 PVAPKPVH-PTLPPNQIKPVPVYPTPATRLITTPGP 287 P P PV+ P PP P PVY P + ++P P Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -3 Query: 394 TP-VAPKPVHPTLPPNQIKPVPVYPTPAT 311 TP VAP+ V P PP Q P PAT Sbjct: 950 TPGVAPRSVQPASPPTQQAAAQAAPAPAT 978 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -3 Query: 394 TP-VAPKPVHPTLPPNQIKPVPVYPTPAT 311 TP VAP+ V P PP Q P PAT Sbjct: 952 TPGVAPRSVQPASPPTQQAAAQAAPAPAT 980 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -3 Query: 382 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 P PVH PP P PV+ P I +P P Sbjct: 782 PPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPP 813 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -3 Query: 382 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSV 278 P PVH PP P PV P + + P P + Sbjct: 714 PPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPI 748 >At2g02490.1 68415.m00188 hydroxyproline-rich glycoprotein family protein related to LENOD2 [Lupinus luteus] gi|296830|emb|CAA39050; and genefinder Length = 302 Score = 28.3 bits (60), Expect = 4.8 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -3 Query: 391 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGS 281 PV P P HP P+Q K +PV P I+ P P S Sbjct: 255 PVPPSPGHP---PHQNKKIPVNQYPRILPISHPVPPS 288 >At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from [Glycine max]; contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 475 Score = 28.3 bits (60), Expect = 4.8 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 4/70 (5%) Frame = -3 Query: 397 LTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSVQQ----LVTFYNSQGKGSVI 230 L P P P+ PP+Q+ P YP+P P PG VT + + G GS Sbjct: 42 LPPPPPPPLETANPPDQV-PSDPYPSP------DPAPGDSDSGCVFDVTSFGAVGDGSCD 94 Query: 229 KPYSYSDAVK 200 ++ DA K Sbjct: 95 DTAAFQDAWK 104 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = -3 Query: 391 PVAPKPVHPTLPPNQIKP---VPVYPTPATRLITTP 293 P P P P+LPP+ + P P TP + +T P Sbjct: 152 PSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPP 187 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 27.9 bits (59), Expect = 6.3 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -3 Query: 406 VTALTPVAPKPVHPTLPP--NQIKPVPVYPT---PATRLITTPGPGSV 278 V + P A P PT PP P PV+PT PA + P V Sbjct: 21 VRTIAPRAAPPARPTTPPPARPTTPPPVWPTTPPPAGAPVAVPAAAHV 68 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -3 Query: 394 TPVAPKPVH-PTLPPNQIKPVPVYPTPATRLITTPGP 287 +P P PV+ P + P+ P PVY P T P P Sbjct: 626 SPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 >At5g65100.1 68418.m08189 ethylene insensitive 3 family protein contains Pfam profile: PF04873 ethylene insensitive 3 Length = 557 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -1 Query: 306 SSPPQDLEACSSSSLSTIARAKEV*SNRTVTAMP*SKVKHLTKISRI 166 SSP A SSSS S I R E + + S +K++ KI + Sbjct: 67 SSPSSSTSASSSSSSSVIVRRTEASRRKKMARSQDSVLKYMMKIMEV 113 >At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 177 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -3 Query: 403 TALTPVAPKPVHPTLP-PNQIKPVPVYPTPATRLITTPGP 287 T +P P P +P+ P+ P P PTP+ + P P Sbjct: 38 TVPSPKVPSPKYPSPSIPSPSVPTPSVPTPSVPTPSVPSP 77 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 27.5 bits (58), Expect = 8.4 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 391 PVAPKPVHPTLPPNQIKPVP-VYPTPATRLITTPGP 287 P P V+P+ PP P P VYP P + P P Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 27.5 bits (58), Expect = 8.4 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 Query: 400 ALTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 287 A P PKP PP + KP P PA + + P P Sbjct: 67 ACPPTPPKPQPKPAPPPEPKPA---PPPAPKPVPCPSP 101 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,386,672 Number of Sequences: 28952 Number of extensions: 273746 Number of successful extensions: 1249 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1192 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -