BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d21f (569 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 22 3.7 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 4.9 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 4.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 6.5 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 8.6 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.6 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +2 Query: 335 PY-SSDAAHHHPRTWKRAAARHF 400 PY S+ AAHHH + + AA F Sbjct: 90 PYVSAAAAHHHHQQQQAVAAAAF 112 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.8 bits (44), Expect = 4.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 9 RQHLRECLVNMKII 50 R HLR CL +K++ Sbjct: 61 RAHLRNCLEKLKVL 74 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 78 GSECRKIYKPIDKNANIDFINMEAGGARPV 167 G C++++ + + DFI + G AR V Sbjct: 53 GEPCQRVHSSRIPDLSYDFIVVGGGAARAV 82 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 6.5 Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = +3 Query: 255 VTALTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTP---GPGSVQQLVTFYNSQG 416 ++AL P LPP+ P+P P + P PGS+ + T + G Sbjct: 394 MSALVSAVRSPAGGQLPPSAGAPMPPIPNMSNMSGMPPLPNMPGSMPTMPTMPSMAG 450 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/27 (25%), Positives = 14/27 (51%) Frame = -1 Query: 230 HGCRSRLDNRRLCEWLISWLPYWPRSP 150 H C R++N + W + + ++ R P Sbjct: 559 HKCFMRVENVKGAVWTVDEVEFYKRRP 585 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 135 INMEAGGARPVGKPTDK 185 +N AGG + GKP ++ Sbjct: 68 VNFVAGGIQQAGKPKEE 84 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 372 PGSVQQLVTFYNSQGKGSVIKPYSYSDAVKQ 464 PG ++ L+T + QG+ IK S+ +Q Sbjct: 1030 PGQIKSLLTGHGLQGQTIFIKQSPSSNQSQQ 1060 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,058 Number of Sequences: 438 Number of extensions: 3071 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -