BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d21f (569 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54930.1 68418.m06841 AT hook motif-containing protein contai... 33 0.13 At3g28790.1 68416.m03593 expressed protein 33 0.13 At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transfera... 33 0.13 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 33 0.18 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 33 0.18 At5g38560.1 68418.m04662 protein kinase family protein contains ... 31 0.41 At4g38080.1 68417.m05378 hydroxyproline-rich glycoprotein family... 31 0.54 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 31 0.54 At2g29740.1 68415.m03614 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.72 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 30 1.2 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 30 1.2 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 30 1.2 At1g07260.1 68414.m00772 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.2 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 29 1.7 At1g14710.2 68414.m01759 hydroxyproline-rich glycoprotein family... 29 1.7 At1g14710.1 68414.m01758 hydroxyproline-rich glycoprotein family... 29 1.7 At1g14430.1 68414.m01711 glyoxal oxidase-related low similarity ... 29 1.7 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 29 2.2 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 29 2.2 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 29 2.2 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 29 2.2 At1g26150.1 68414.m03192 protein kinase family protein similar t... 29 2.2 At5g61090.1 68418.m07665 proline-rich family protein contains pr... 29 2.9 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 29 2.9 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 29 2.9 At4g16280.1 68417.m02469 flowering time control protein / FCA ga... 29 2.9 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 29 2.9 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 28 3.8 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 28 3.8 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 28 3.8 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 28 3.8 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 28 3.8 At2g02490.1 68415.m00188 hydroxyproline-rich glycoprotein family... 28 3.8 At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein /... 28 3.8 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 28 5.0 At1g47660.1 68414.m05295 hypothetical protein 28 5.0 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 28 5.0 At5g65100.1 68418.m08189 ethylene insensitive 3 family protein c... 27 6.7 At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid t... 27 6.7 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 27 6.7 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 27 6.7 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 27 8.8 At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protei... 27 8.8 At4g02000.1 68417.m00269 expressed protein low similarity to zin... 27 8.8 At3g21290.1 68416.m02690 dentin sialophosphoprotein-related cont... 27 8.8 At2g27120.1 68415.m03259 DNA-directed DNA polymerase epsilon cat... 27 8.8 At2g13450.1 68415.m01484 hypothetical protein similar to zinc fi... 27 8.8 At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-conta... 27 8.8 At1g08260.1 68414.m00911 DNA-directed DNA polymerase epsilon cat... 27 8.8 >At5g54930.1 68418.m06841 AT hook motif-containing protein contains Pfam profile PF02178: AT hook motif Length = 286 Score = 33.1 bits (72), Expect = 0.13 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +3 Query: 261 ALTPVAPKPVHPTLPPNQIKPVPVYP 338 AL PV +P HPT+P N I PV + P Sbjct: 150 ALVPVPIQPAHPTIPNNLIVPVVLQP 175 >At3g28790.1 68416.m03593 expressed protein Length = 608 Score = 33.1 bits (72), Expect = 0.13 Identities = 23/64 (35%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +3 Query: 267 TPVAPKPVHPT-LPPNQIKPVPVYPTPATRLITTPGPGSVQQLVTFYNSQGKGSVIKPYS 443 TP P P PT P P P PTP+T +TP G + + S K S K S Sbjct: 282 TPSTPTPSTPTPSTPTPSTPTPSTPTPSTPAPSTPAAGKTSEKGSESASMKKESNSKSES 341 Query: 444 YSDA 455 S A Sbjct: 342 ESAA 345 >At1g07250.1 68414.m00771 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose glucosyltransferase GI:453245 from [Manihot esculenta] Length = 479 Score = 33.1 bits (72), Expect = 0.13 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -1 Query: 455 GIAVTVRFDYTSFALAIVESDELLHASRSW--GGDEPRR 345 G+AV +R DY S +V DE+ A RS GGDE R+ Sbjct: 404 GLAVDLRMDYVSSRGGLVTCDEIARAVRSLMDGGDEKRK 442 >At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 299 Score = 32.7 bits (71), Expect = 0.18 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSVQQLVT 398 PVAP P P PP P P P AT +TTP P V ++ Sbjct: 117 PVAPAPTRP--PPPAPTPTPA-PVAATETVTTPIPEPVPATIS 156 >At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain; Length = 419 Score = 32.7 bits (71), Expect = 0.18 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSVQQLVT 398 PVAP P P PP P P P AT +TTP P V ++ Sbjct: 117 PVAPAPTRP--PPPAPTPTPA-PVAATETVTTPIPEPVPATIS 156 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 31.5 bits (68), Expect = 0.41 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 267 TPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGS 380 TP AP PV P P Q P V +P ++++P P S Sbjct: 31 TPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSS 68 >At4g38080.1 68417.m05378 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Common family member: At2g22510 [Arabidopsis thaliana] Length = 128 Score = 31.1 bits (67), Expect = 0.54 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 267 TPVAPKPV--HPTLPPNQIKPVPVYPTPATRLITTPGP 374 TPV P P LP + PVP PTP + + P P Sbjct: 35 TPVTQPPALTFPPLPKTTMPPVPSLPTPGQQTLPQPQP 72 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.1 bits (67), Expect = 0.54 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 258 TALTPVAPKPVHPTL-PPNQIKPVPVYPTPATRLITTPGP 374 T P P P P + PP PV PTP ++T P P Sbjct: 161 TPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTP 200 Score = 30.3 bits (65), Expect = 0.95 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +3 Query: 264 LTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 +TP P P T PP PV PTP +IT P P Sbjct: 185 ITPPTPTPPVVT-PPTPTPPVITPPTPTPPVITPPTP 220 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +3 Query: 264 LTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 +TP P P T PP PV PTP +IT P P Sbjct: 175 VTPPTPTPPVIT-PPTPTPPVVTPPTPTPPVITPPTP 210 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 264 LTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 +TP P P T PP PV PTP ++T P P Sbjct: 205 ITPPTPTPPVIT-PPTPTPPVVTPPTPTPPVVTPPTP 240 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 P PKP H PP P P PTP ++T P P Sbjct: 148 PSTPKPPHHKPPPTPCPP-PT-PTPTPPVVTPPTP 180 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 279 PKPVHPTL-PPNQIKPVPVYPTPATRLITTPGP 374 P P P + PP PV PTP ++T P P Sbjct: 198 PTPTPPVITPPTPTPPVITPPTPTPPVVTPPTP 230 >At2g29740.1 68415.m03614 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 474 Score = 30.7 bits (66), Expect = 0.72 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = -1 Query: 455 GIAVTVRFDYTSFALAIVESDELLHASRSW--GGDEPRR 345 G+A+ +R DY S IV++DE+ A RS G D PRR Sbjct: 406 GLALEMRLDYVSEYGEIVKADEIAGAVRSLMDGEDVPRR 444 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 29.9 bits (64), Expect = 1.2 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = +3 Query: 261 ALTPVAPKPVHPTLPPNQIKPVPV-YPTPA--TRLITTPGPGSVQQLVTFYNSQGKGS 425 A TP PKP PP KP P PTPA + P PG + T ++ + KG+ Sbjct: 91 APTPPNPKPTPAPTPPKP-KPAPAPAPTPAPKPKPAPKPAPGGEVEDETEFSYETKGN 147 Score = 28.7 bits (61), Expect = 2.9 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 261 ALTPVAPKPVH-PTLPPNQIKPVPVYPTPATRLITTP 368 A TP PKP PT P + KP P P P TP Sbjct: 69 APTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTP 105 Score = 28.3 bits (60), Expect = 3.8 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 261 ALTPVAPKPVH-PTLPPNQIKPVPVYPTPATRLITTP 368 A TP PKP PT P + KP P P P TP Sbjct: 36 APTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTP 72 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSV 383 P P P LPP P V PTP++ +TP PG++ Sbjct: 589 PSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTPGTL 626 Score = 27.1 bits (57), Expect = 8.8 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 264 LTPVAPKPVHPTLPPNQIKPVPVYPTPATRL 356 L PV P P P + P P P PTP T L Sbjct: 599 LPPVIPSP--PIVGPTPSSPPPSTPTPGTLL 627 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 267 TPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 +P P P++ PP P PVY +P + +P P Sbjct: 542 SPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPP 577 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 267 TPVAPKPVHPTLPPNQIKPVPVY-PTPAT 350 +P P PV+ PP+ P PVY P P T Sbjct: 608 SPPPPSPVYSPPPPSHSPPPPVYSPPPPT 636 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +3 Query: 270 PVAPKPVH-PTLPPNQIKPVPVYPTPATRLITTPGPGS 380 P P PVH P PP P PV+ P + +P P S Sbjct: 585 PSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPS 622 >At1g07260.1 68414.m00772 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 476 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = -1 Query: 455 GIAVTVRFDYTSFALAIVESDELLHASRSW--GGDEPRR 345 G+AV +R DY S IV+++E+ A RS G D PR+ Sbjct: 403 GLAVELRLDYVSAYGEIVKAEEIAGAIRSLMDGEDTPRK 441 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 279 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 P PVH PP P PVY P + +P P Sbjct: 596 PPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPP 627 Score = 29.1 bits (62), Expect = 2.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 279 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 P PVH PP P PVY P + + P P Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 279 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 P PVH PP P PVY P + + P P Sbjct: 633 PPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 27.1 bits (57), Expect = 8.8 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 279 PKPVHPTLPPNQI---KPVPVYPTPATRLITTPGP 374 P PVH PP+ I P PVY P + +P P Sbjct: 495 PPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPP 529 >At1g14710.2 68414.m01759 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 601 Score = 29.5 bits (63), Expect = 1.7 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +3 Query: 270 PVAPKPVHPTLPPN---QIKPVPVYPTPATRLITTPGPGSVQQLVTFYN-SQGK 419 P P PV P LPP+ Q P P P P T + PGS Q+L N ++GK Sbjct: 524 PTGP-PVWPLLPPHPRHQTAPQPRMPIPGTGVFLP--PGSNQELADNSNGTEGK 574 >At1g14710.1 68414.m01758 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 601 Score = 29.5 bits (63), Expect = 1.7 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +3 Query: 270 PVAPKPVHPTLPPN---QIKPVPVYPTPATRLITTPGPGSVQQLVTFYN-SQGK 419 P P PV P LPP+ Q P P P P T + PGS Q+L N ++GK Sbjct: 524 PTGP-PVWPLLPPHPRHQTAPQPRMPIPGTGVFLP--PGSNQELADNSNGTEGK 574 >At1g14430.1 68414.m01711 glyoxal oxidase-related low similarity to glyoxal oxidase precursor (glx1) [Phanerochaete chrysosporium] GI:1050302 Length = 849 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +3 Query: 288 VHPTLPPNQIKPVPVY-PTPATRLITTPGPGSVQQLVTFYNSQGKGSVIKP 437 VH +P + + V PTP ++ P S L+ FYN G V+ P Sbjct: 551 VHRGIPSVAVWEISVKTPTPREKIFDFVCPSSCDGLICFYNLYKSGIVVNP 601 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 7/40 (17%) Frame = +3 Query: 270 PVAPKPVHPTLPPN-------QIKPVPVYPTPATRLITTP 368 P+ P PTLPPN + P+P+ PTP T L T P Sbjct: 276 PLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPT-LPTIP 314 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 267 TPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 TP P P P PP P P P+P + T P P Sbjct: 141 TPSVPSPTPPVSPPPPT-PTPSVPSPTPPVPTDPMP 175 Score = 27.9 bits (59), Expect = 5.0 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 267 TPVAPKPVHPT-LPPNQIKPVPVYPTPATRLITTPGPGSV 383 TP P P P P P PV P P T + P P V Sbjct: 159 TPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDV 198 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 267 TPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 TP P+ P PP Q+ P P P+P TP P Sbjct: 716 TPTYSPPIKP--PPVQVPPTPTTPSPPQGGYGTPPP 749 Score = 27.5 bits (58), Expect = 6.7 Identities = 24/65 (36%), Positives = 27/65 (41%), Gaps = 6/65 (9%) Frame = +3 Query: 270 PVAPKPVH----PTL-PPNQIKPVPVYPTPATRLITTPGPGSVQQLVTFYN-SQGKGSVI 431 PV P PV PT PP + PV V PTP P P V T + QG Sbjct: 688 PVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTP 747 Query: 432 KPYSY 446 PY+Y Sbjct: 748 PPYAY 752 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 29.1 bits (62), Expect = 2.2 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSV 383 PV P P P +PP Q VPV P P +I+ P ++ Sbjct: 155 PVMPPPQVPVMPPPQ---VPVKPHPKVPVISPDPPATL 189 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = +3 Query: 276 APKPVHP-TLPPNQIKPVPVYPT--PATRLITTPGP 374 AP P +P + PP + P P PT P T IT+P P Sbjct: 108 APPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSP 143 >At5g61090.1 68418.m07665 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; common family members: At4g18570, At3g25690, At4g04980 [Arabidopsis thaliana] Length = 344 Score = 28.7 bits (61), Expect = 2.9 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +3 Query: 267 TPVAPKPVHPTLPPNQI-KPVPVYPTPATRLITTPGP 374 TP AP+ V P P +I +PVP PTP T T P Sbjct: 100 TPEAPRSV-PACPIPEIPRPVPARPTPETPRPVTARP 135 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 279 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGS 380 PKP TLP NQ P+ Y P + PG S Sbjct: 363 PKPGQATLPSNQGGPLGGYGVPPLNPLPVPGVSS 396 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 279 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGS 380 PKP TLP NQ P+ Y P + PG S Sbjct: 363 PKPGQATLPSNQGGPLGGYGVPPLNPLPVPGVSS 396 >At4g16280.1 68417.m02469 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 505 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 279 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGS 380 PKP TLP NQ P+ Y P + PG S Sbjct: 121 PKPGQATLPSNQGGPLGGYGVPPLNPLPVPGVSS 154 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 28.7 bits (61), Expect = 2.9 Identities = 13/47 (27%), Positives = 21/47 (44%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSVQQLVTFYNS 410 P P P + PP+ + P P P P + T PG + + +Y + Sbjct: 67 PSPPPPKKSSCPPSPLPPPP--PPPPPNYVFTYPPGDLYPIENYYGA 111 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTP 368 P+ P P++ PP I P P+Y P T + P Sbjct: 79 PIYPPPIYSP-PPPPIYPPPIYSPPPTPISPPP 110 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +3 Query: 270 PVAPKPVH-PTLPPNQIKPVPVYPTPATRLITTPGP 374 P P PV+ P PP P PVY P + ++P P Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +3 Query: 267 TP-VAPKPVHPTLPPNQIKPVPVYPTPAT 350 TP VAP+ V P PP Q P PAT Sbjct: 950 TPGVAPRSVQPASPPTQQAAAQAAPAPAT 978 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 28.3 bits (60), Expect = 3.8 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +3 Query: 267 TP-VAPKPVHPTLPPNQIKPVPVYPTPAT 350 TP VAP+ V P PP Q P PAT Sbjct: 952 TPGVAPRSVQPASPPTQQAAAQAAPAPAT 980 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 28.3 bits (60), Expect = 3.8 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 279 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 P PVH PP P PV+ P I +P P Sbjct: 782 PPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPP 813 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +3 Query: 279 PKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSV 383 P PVH PP P PV P + + P P + Sbjct: 714 PPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPI 748 >At2g02490.1 68415.m00188 hydroxyproline-rich glycoprotein family protein related to LENOD2 [Lupinus luteus] gi|296830|emb|CAA39050; and genefinder Length = 302 Score = 28.3 bits (60), Expect = 3.8 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGS 380 PV P P HP P+Q K +PV P I+ P P S Sbjct: 255 PVPPSPGHP---PHQNKKIPVNQYPRILPISHPVPPS 288 >At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from [Glycine max]; contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 475 Score = 28.3 bits (60), Expect = 3.8 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 4/70 (5%) Frame = +3 Query: 264 LTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSVQQ----LVTFYNSQGKGSVI 431 L P P P+ PP+Q+ P YP+P P PG VT + + G GS Sbjct: 42 LPPPPPPPLETANPPDQV-PSDPYPSP------DPAPGDSDSGCVFDVTSFGAVGDGSCD 94 Query: 432 KPYSYSDAVK 461 ++ DA K Sbjct: 95 DTAAFQDAWK 104 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKP---VPVYPTPATRLITTP 368 P P P P+LPP+ + P P TP + +T P Sbjct: 152 PSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPP 187 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = +3 Query: 255 VTALTPVAPKPVHPTLPP--NQIKPVPVYPT---PATRLITTPGPGSV 383 V + P A P PT PP P PV+PT PA + P V Sbjct: 21 VRTIAPRAAPPARPTTPPPARPTTPPPVWPTTPPPAGAPVAVPAAAHV 68 Score = 27.1 bits (57), Expect = 8.8 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSV 383 P P PV PT PP PV V PA + P V Sbjct: 42 PTTPPPVWPTTPPPAGAPVAV---PAAAHVAVPAAAPV 76 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 27.9 bits (59), Expect = 5.0 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 267 TPVAPKPVH-PTLPPNQIKPVPVYPTPATRLITTPGP 374 +P P PV+ P + P+ P PVY P T P P Sbjct: 626 SPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 >At5g65100.1 68418.m08189 ethylene insensitive 3 family protein contains Pfam profile: PF04873 ethylene insensitive 3 Length = 557 Score = 27.5 bits (58), Expect = 6.7 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 355 SSPPQDLEACSSSSLSTIARAKEV*SNRTVTAMP*SKVKHLTKISRI 495 SSP A SSSS S I R E + + S +K++ KI + Sbjct: 67 SSPSSSTSASSSSSSSVIVRRTEASRRKKMARSQDSVLKYMMKIMEV 113 >At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 177 Score = 27.5 bits (58), Expect = 6.7 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +3 Query: 258 TALTPVAPKPVHPTLP-PNQIKPVPVYPTPATRLITTPGP 374 T +P P P +P+ P+ P P PTP+ + P P Sbjct: 38 TVPSPKVPSPKYPSPSIPSPSVPTPSVPTPSVPTPSVPSP 77 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVP-VYPTPATRLITTPGP 374 P P V+P+ PP P P VYP P + P P Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +3 Query: 261 ALTPVAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGP 374 A P PKP PP + KP P PA + + P P Sbjct: 67 ACPPTPPKPQPKPAPPPEPKPA---PPPAPKPVPCPSP 101 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 27.1 bits (57), Expect = 8.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTP 344 P P PVH PP P PVY P Sbjct: 559 PPPPPPVHSPPPPVFSPPPPVYSPP 583 >At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protein similar to SP|Q40374 Pathogenesis-related protein PR-1 precursor {Medicago truncatula}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 210 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 282 KPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSVQ 386 +P+ P+ PP KP P+ PTP+ + I P + Q Sbjct: 35 RPITPSPPPYVAKPQPL-PTPSPKPILYQPPPTYQ 68 >At4g02000.1 68417.m00269 expressed protein low similarity to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 314 Score = 27.1 bits (57), Expect = 8.8 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = +3 Query: 267 TPVAPKP--VHPTLPPNQIKPVPVYPTPATRLITTPG-PGSVQQLVTFYNSQGKGSVIKP 437 TP+ P P HP L P+++ V Y P TR + P G + Q+ N + S I+P Sbjct: 186 TPIDPPPRIPHPPLNPDEL--VAAY-YPHTRATSLPNFAGPLPQVPLRKNVDERDSNIQP 242 Query: 438 YS 443 +S Sbjct: 243 FS 244 >At3g21290.1 68416.m02690 dentin sialophosphoprotein-related contains weak similarity to Dentin sialophosphoprotein precursor (Swiss-Prot:Q9NZW4) [Homo sapiens] Length = 1192 Score = 27.1 bits (57), Expect = 8.8 Identities = 19/62 (30%), Positives = 27/62 (43%) Frame = +3 Query: 273 VAPKPVHPTLPPNQIKPVPVYPTPATRLITTPGPGSVQQLVTFYNSQGKGSVIKPYSYSD 452 V P PV P +P PT RL +PGP Q T G G++ K ++ ++ Sbjct: 245 VDPPPVPVGGPKPSFRPGASTPTMKNRLSASPGPSPSNQYNT--PPYGIGNMAKTHAANE 302 Query: 453 AV 458 V Sbjct: 303 NV 304 >At2g27120.1 68415.m03259 DNA-directed DNA polymerase epsilon catalytic subunit, putative similar to SP|Q07864 DNA polymerase epsilon, catalytic subunit A (EC 2.7.7.7) (DNA polymerase II subunit A) {Homo sapiens}; contains Pfam profiles: PF03175 DNA polymerase type B, organellar and viral, PF00136 DNA polymerase family B, PF03104 DNA polymerase family B, exonuclease domain Length = 2138 Score = 27.1 bits (57), Expect = 8.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 314 D*ACASVPYSSDAAHHHPRTWKRAAAR 394 D C +P++ D + P +W+R AA+ Sbjct: 1546 DFPCVRIPFNDDDNSYQPVSWQRPAAK 1572 >At2g13450.1 68415.m01484 hypothetical protein similar to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 394 Score = 27.1 bits (57), Expect = 8.8 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = +3 Query: 267 TPVAPKP--VHPTLPPNQIKPVPVYPTPATRLITTPG-PGSVQQLVTFYNSQGKGSVIKP 437 TP+ P P HP L P+++ V Y P TR + P G + Q+ N + S I+P Sbjct: 266 TPIDPPPRIPHPPLNPDEL--VAAY-YPHTRATSLPNFAGPLPQVPLRRNVDERDSNIQP 322 Query: 438 YS 443 +S Sbjct: 323 FS 324 >At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226: DnaJ domain Length = 797 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 270 PVAPKPVHPTLPPNQIKPVPVYPTPATRLITTP 368 P KP+ + PP KP+PV P T T P Sbjct: 530 PNTSKPMPVSQPPTTSKPLPVSQPPPTFQSTCP 562 >At1g08260.1 68414.m00911 DNA-directed DNA polymerase epsilon catalytic subunit, putative similar to SP|Q07864 DNA polymerase epsilon, catalytic subunit A (EC 2.7.7.7) (DNA polymerase II subunit A) {Homo sapiens}; contains Pfam profiles: PF03175 DNA polymerase type B, organellar and viral, PF00136 DNA polymerase family B, PF03104 DNA polymerase family B, exonuclease domain Length = 2271 Score = 27.1 bits (57), Expect = 8.8 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 314 D*ACASVPYSSDAAHHHPRTWKRAAAR 394 D C +P++ D + P +W+R AA+ Sbjct: 1589 DFPCVRIPFNDDDNSYQPVSWQRPAAK 1615 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,816,538 Number of Sequences: 28952 Number of extensions: 246463 Number of successful extensions: 1201 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1144 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -