BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d20r (735 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.10 |atp9||F0-ATPase subunit 9; similar to S. cerevisiae Q0... 42 1e-04 SPBC36.11 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||M... 29 0.69 SPAC17C9.12 |||MSP domain|Schizosaccharomyces pombe|chr 1|||Manual 25 8.5 >SPMIT.10 |atp9||F0-ATPase subunit 9; similar to S. cerevisiae Q0130|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 74 Score = 41.5 bits (93), Expect = 1e-04 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -3 Query: 562 FGSLIIGYARNPSLKQQLFSYAILGFALSE 473 F +LI G +RNPS++ LFS AILGFAL+E Sbjct: 28 FSNLISGTSRNPSVRPHLFSMAILGFALTE 57 >SPBC36.11 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 343 Score = 29.1 bits (62), Expect = 0.69 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 269 AHCRCNTHQSLHHYEGEVSKHSIPWLSTP 355 A R NT Q Y G HS PW S+P Sbjct: 146 AAVRKNTEQEKMGYRGGYQMHSTPWASSP 174 >SPAC17C9.12 |||MSP domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 25.4 bits (53), Expect = 8.5 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +2 Query: 248 INCIPVDAHCRCNTHQSLHHYEGEVSKHSIPWLST 352 I C+ + N H + HH + + SIP +T Sbjct: 116 IRCVYSEGPSTANAHANAHHQPAQTTTTSIPTSAT 150 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,002,892 Number of Sequences: 5004 Number of extensions: 58438 Number of successful extensions: 130 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -