BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d17f (627 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0283 + 13887388-13887573,13887711-13887806,13888517-138886... 130 9e-31 04_04_0712 + 27476319-27476569,27477150-27477402,27477535-274779... 69 4e-12 03_02_0650 + 10174905-10175000,10175321-10175376,10175467-101755... 68 5e-12 02_05_0183 + 26537676-26537752,26538481-26538649,26538736-265389... 66 3e-11 03_06_0226 + 32495088-32495237,32496189-32496351,32496438-324965... 64 9e-11 03_05_0497 + 24932336-24932485,24934037-24934199,24934306-249344... 64 9e-11 05_01_0411 + 3243025-3243092,3243348-3243496,3243740-3243872,324... 64 1e-10 01_05_0327 + 20984336-20985478 61 6e-10 12_02_1140 + 26411424-26411998,26412491-26412761,26412848-26413405 60 1e-09 05_03_0564 - 15502458-15503303,15503394-15503474,15503572-155036... 60 2e-09 05_03_0563 - 15493570-15494415,15494506-15494586,15494684-154947... 60 2e-09 05_03_0562 - 15484733-15485578,15485669-15485749,15485847-154858... 60 2e-09 02_01_0717 + 5351504-5351602,5353401-5353499,5353574-5353675,535... 60 2e-09 05_04_0027 - 17298727-17299830 59 2e-09 08_01_0408 - 3616655-3617108,3617190-3617596,3618120-3618287 58 6e-09 08_02_1300 + 25972496-25972582,25972664-25972723,25973786-259738... 58 8e-09 02_05_0699 + 31013176-31013345,31013749-31013872,31013950-310140... 57 1e-08 06_01_0929 - 7171395-7171676,7172019-7172219,7172438-7172524,717... 56 2e-08 06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-92... 56 3e-08 05_01_0207 + 1493224-1493385,1493475-1493839,1494313-1494390,149... 55 5e-08 05_07_0111 - 27752339-27752777,27753356-27753840,27753956-27754120 54 1e-07 05_06_0267 - 26784861-26784896,26785324-26785404,26785530-267857... 52 4e-07 01_06_0406 + 29113033-29113119,29113250-29113309,29114104-291141... 52 4e-07 02_04_0220 - 21014225-21014386,21014492-21014572,21014739-210149... 52 5e-07 06_03_1400 + 29901835-29902136,29902913-29902934 51 9e-07 06_03_0949 - 26262993-26263130,26263602-26263670,26263809-26264030 50 2e-06 02_03_0378 + 18327622-18329826 50 2e-06 12_01_0438 + 3455686-3455692,3456149-3456240,3457422-3457505,345... 50 2e-06 04_03_0735 + 19141038-19143227 50 2e-06 03_02_0205 + 6389343-6389609,6390418-6390486,6390662-6390757,639... 49 3e-06 03_01_0260 - 1999462-1999488,1999748-1999930,2000940-2001146,200... 49 3e-06 02_05_0821 - 32019775-32019882,32020296-32020352,32020614-320206... 49 3e-06 02_01_0713 - 5332145-5332351,5332675-5332893,5334347-5334559,533... 48 6e-06 01_07_0380 + 43181564-43181639,43182053-43182218,43182494-431826... 48 8e-06 08_02_1491 + 27500532-27500972 47 1e-05 03_02_0845 - 11700830-11701327 47 1e-05 01_01_0976 + 7711634-7711801,7712741-7713183,7715813-7716251 46 2e-05 06_03_0339 - 19687749-19690805 46 2e-05 03_02_0438 + 8470290-8470378,8470900-8470990,8471074-8471134,847... 46 2e-05 01_07_0010 + 40429613-40429677,40429702-40430015,40432150-40434386 46 3e-05 03_06_0049 + 31282563-31282841,31283052-31283903,31284109-312841... 45 4e-05 01_05_0646 + 23907837-23907956,23908077-23908164,23908282-239083... 45 4e-05 02_02_0600 + 12018256-12018502,12018943-12019073,12019104-12019553 45 6e-05 01_05_0147 + 18597194-18597643,18598347-18598681,18600073-186001... 45 6e-05 12_02_1085 - 25935688-25935948,25936589-25936657,25937244-259373... 44 8e-05 12_02_0454 + 19199063-19200757,19202201-19202287 44 1e-04 03_06_0554 + 34691050-34691242,34691327-34691394,34691754-34692275 44 1e-04 02_05_0381 - 28483425-28483458,28483588-28483658,28483746-284838... 44 1e-04 06_01_0806 - 6048042-6048138,6048461-6048550,6049362-6049425,604... 43 2e-04 03_06_0568 - 34778408-34778710,34779340-34779411,34779549-347796... 43 2e-04 03_03_0278 - 16126803-16129049 43 2e-04 01_04_0054 - 15456668-15459691 42 3e-04 12_01_0915 - 8908643-8908756,8909086-8909203,8909570-8909682,891... 42 4e-04 11_06_0179 + 20952070-20955228 42 4e-04 02_01_0225 - 1469295-1469733,1472352-1472767,1473603-1473658,147... 42 4e-04 09_04_0594 - 18831011-18831360,18831562-18832111,18832364-188334... 42 5e-04 01_01_1212 + 9763949-9764412,9765183-9765252,9765356-9765457 41 7e-04 11_01_0725 - 5987706-5988126,5988610-5988902 39 0.003 07_03_1296 + 25583195-25584385 39 0.004 03_02_0704 - 10542187-10542339,10542466-10542522,10542667-105427... 39 0.004 01_01_1190 + 9463973-9465732,9466210-9466440,9467664-9467793,946... 38 0.005 01_01_0013 + 81507-81932,82718-82864 38 0.005 08_02_0992 + 23380855-23381195,23382464-23382506,23383306-233833... 38 0.007 08_02_0469 - 17531189-17531678,17531773-17531798,17533511-17533669 38 0.009 04_04_1571 + 34504087-34504421,34505002-34505731,34506091-345120... 37 0.015 01_06_0592 + 30465956-30466210,30466401-30466529,30466631-304667... 36 0.020 01_01_1211 + 9753518-9753894,9754265-9754313,9754747-9754773 36 0.035 06_01_0667 + 4878784-4878900,4879016-4879118,4879256-4879341,487... 35 0.046 05_06_0167 - 26104527-26104567,26105130-26105226,26105377-261054... 35 0.046 11_06_0153 - 20693663-20693689,20693808-20694096,20694493-206948... 35 0.061 10_08_1023 - 22341815-22342042,22342179-22342247,22342717-223428... 34 0.080 09_03_0078 + 12137124-12137672 34 0.080 10_08_0580 - 18912364-18912420,18912524-18912631,18912973-189132... 34 0.11 01_05_0090 + 18038219-18038421,18039365-18039488,18040229-180403... 34 0.11 09_04_0406 + 17340129-17340650 33 0.14 07_03_1417 + 26418131-26418178,26418410-26418502,26418861-264188... 33 0.19 03_05_0019 + 19862171-19863049 33 0.19 03_06_0601 + 34991912-34992352,34993719-34994516 33 0.25 07_03_1340 + 25887135-25887372,25887676-25887798,25888388-258885... 32 0.32 05_07_0247 + 28643862-28644310,28645151-28645207,28645644-286489... 32 0.32 02_05_1130 - 34319558-34319603,34320236-34320335,34320498-343205... 32 0.32 11_06_0632 + 25674807-25675477,25676472-25677861,25677948-256780... 32 0.43 01_03_0254 - 14276308-14276313,14277101-14277277,14278290-14278688 32 0.43 08_02_0878 + 22152437-22152532,22152619-22152718,22152907-221529... 31 0.57 03_02_0727 - 10742899-10744375,10744470-10744933,10745412-10745477 31 0.57 01_05_0808 - 25414486-25414677,25415114-25415290,25415839-254159... 31 0.57 12_02_0693 - 22207582-22207620,22208421-22208597,22209258-222093... 31 0.75 11_08_0055 - 28095996-28096934 31 0.75 07_03_0325 - 16809700-16809774,16810262-16810316,16810467-168107... 31 0.75 03_06_0599 + 34984869-34985319,34986581-34987563 31 0.75 08_01_0188 - 1575000-1575062,1575192-1575263,1575371-1575466,157... 30 1.3 10_08_0380 - 17391427-17391435,17392026-17392097,17392215-173923... 30 1.7 10_01_0130 + 1540412-1541173 29 2.3 07_03_1759 + 29285262-29287208 29 2.3 02_01_0383 + 2776526-2776632,2777579-2777835,2777915-2778366,277... 29 3.0 07_01_0042 - 334417-334431,334563-334688,334852-335136,335220-33... 29 4.0 03_06_0600 + 34988743-34989407,34990033-34990051 29 4.0 03_02_0030 + 5129234-5129568,5130020-5130651,5130936-5131243,513... 29 4.0 06_03_0151 + 17270688-17270698,17271149-17271281,17271548-172715... 28 5.3 09_04_0165 + 15274448-15277336 28 7.0 09_03_0148 + 12770010-12770266,12772172-12772314,12773214-127735... 28 7.0 01_05_0633 + 23840427-23840562,23840699-23840768,23840846-238409... 28 7.0 10_08_0184 - 15570471-15570684,15571085-15571354,15571489-155717... 27 9.2 >04_03_0283 + 13887388-13887573,13887711-13887806,13888517-13888637, 13888734-13888840,13888949-13889166,13890219-13890396, 13890492-13890611,13891601-13891687,13892401-13892511, 13892618-13893439 Length = 681 Score = 130 bits (314), Expect = 9e-31 Identities = 72/183 (39%), Positives = 104/183 (56%), Gaps = 5/183 (2%) Frame = +1 Query: 94 DESGSTFFYFVLSFLALILVPATFYYWPKKRKEDPAKLAERCQCPNCVSKQLIIEQSQPY 273 +E+ S F F+L+ +AL LVP T + + C+C C + Y Sbjct: 5 EENSSLFLIFILTMIALPLVPYTIMRLCRAANVKAKTI--HCRCSGCHRSGKY--RKSIY 60 Query: 274 KSVKNFFV--KLAIVSGWVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYR 447 K + NF L I+ W+++ FL Y + E+ F+PY ILGL PGA++++IKKSYR Sbjct: 61 KRISNFSTCSNLTILLLWIVMIFLVYYIKHVSREVQVFEPYSILGLEPGASESDIKKSYR 120 Query: 448 KQSLVLHPDKETGDE--KAFMR-LTKAYQALTDDEARRNWEKYGNPDGPGAMSFGIALPS 618 + S+ HPDK E K F+ ++KAYQALTD +R N+EKYG+PDG M GIALP Sbjct: 121 RLSIQYHPDKNPDPEAHKYFVEFISKAYQALTDPVSRENYEKYGHPDGRQGMQMGIALPK 180 Query: 619 WIV 627 +++ Sbjct: 181 FLL 183 >04_04_0712 + 27476319-27476569,27477150-27477402,27477535-27477914, 27479738-27479864,27479945-27480110,27480221-27480359, 27481854-27481987,27482087-27482229,27482367-27482565, 27482688-27483010 Length = 704 Score = 68.5 bits (160), Expect = 4e-12 Identities = 36/83 (43%), Positives = 52/83 (62%), Gaps = 3/83 (3%) Frame = +1 Query: 358 FDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTD 537 F E +N YE+LG+P A++ E+KK+YRK ++ HPDK GD + F L++AY+ LTD Sbjct: 292 FGMESNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDK-GGDPEKFKELSQAYEVLTD 350 Query: 538 DEARRNWEKYGN---PDGPGAMS 597 E R +++YG DG G S Sbjct: 351 PEKRDIYDQYGEDALKDGMGGGS 373 >03_02_0650 + 10174905-10175000,10175321-10175376,10175467-10175540, 10176215-10176753,10176845-10177186,10177520-10177879, 10177982-10178193,10178881-10179169,10179469-10180152 Length = 883 Score = 68.1 bits (159), Expect = 5e-12 Identities = 31/74 (41%), Positives = 48/74 (64%), Gaps = 3/74 (4%) Frame = +1 Query: 376 NFDPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEAR 549 N DPY++LG+ A+Q +I+K++ K SL HPD K G ++ F + AY L+D+E R Sbjct: 27 NLDPYKVLGVDKSASQRDIQKAFHKLSLKYHPDKNKSKGAQEKFAEINNAYDILSDEEKR 86 Query: 550 RNWEKYGNPDG-PG 588 +N++ YG+ G PG Sbjct: 87 KNYDLYGDEKGNPG 100 >02_05_0183 + 26537676-26537752,26538481-26538649,26538736-26538910, 26539008-26539137,26540425-26540558,26540629-26540771, 26540894-26541092,26541183-26541514 Length = 452 Score = 65.7 bits (153), Expect = 3e-11 Identities = 32/79 (40%), Positives = 48/79 (60%) Frame = +1 Query: 334 FLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLT 513 FL+ + + +N YE+LG+ ATQ E+KK+YRK ++ HPDK GD + F L Sbjct: 29 FLSVMYGRMPKKSNNTKYYEVLGVSKTATQDELKKAYRKAAIKNHPDK-GGDPEKFKELA 87 Query: 514 KAYQALTDDEARRNWEKYG 570 +AY+ L D E R +++YG Sbjct: 88 QAYEVLNDPEKREIYDQYG 106 >03_06_0226 + 32495088-32495237,32496189-32496351,32496438-32496576, 32496669-32496945,32497051-32497249,32497379-32497704 Length = 417 Score = 64.1 bits (149), Expect = 9e-11 Identities = 28/61 (45%), Positives = 43/61 (70%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEARRNWEKY 567 YE+LG+P A+Q ++KK+YRK ++ HPDK GD + F L +AY+ L+D E R +++Y Sbjct: 15 YEVLGVPKDASQDDLKKAYRKAAIKNHPDK-GGDPEKFKELAQAYEVLSDPEKREIYDQY 73 Query: 568 G 570 G Sbjct: 74 G 74 >03_05_0497 + 24932336-24932485,24934037-24934199,24934306-24934447, 24934528-24934804,24934887-24935085,24935169-24935491 Length = 417 Score = 64.1 bits (149), Expect = 9e-11 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEARRNWEKY 567 YEILG+P A+Q ++KK+YRK ++ HPDK GD + F L +AY+ L+D E R +++Y Sbjct: 15 YEILGVPKTASQDDLKKAYRKAAIKNHPDK-GGDPEKFKELAQAYEVLSDPEKREIYDQY 73 Query: 568 G 570 G Sbjct: 74 G 74 >05_01_0411 + 3243025-3243092,3243348-3243496,3243740-3243872, 3244740-3244860,3245065-3245181,3245303-3245389, 3245941-3246000,3246097-3246174,3246587-3246658, 3246767-3246925 Length = 347 Score = 63.7 bits (148), Expect = 1e-10 Identities = 28/64 (43%), Positives = 44/64 (68%), Gaps = 3/64 (4%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARRNW 558 Y++L +P GA++ +IK+SYRK +L HPDK +E+A F + AY+ LTD E R+ + Sbjct: 27 YDVLQVPKGASEDQIKRSYRKLALKYHPDKNPNNEEANKRFAEINNAYEILTDQEKRKIY 86 Query: 559 EKYG 570 ++YG Sbjct: 87 DRYG 90 >01_05_0327 + 20984336-20985478 Length = 380 Score = 61.3 bits (142), Expect = 6e-10 Identities = 29/68 (42%), Positives = 45/68 (66%), Gaps = 2/68 (2%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKE--TGDEKAFMRLTKAYQALTDDEARRN 555 D Y+ILGL T +++K+YRK SL +HPDK G E AF ++KA+Q L+D E+R+ Sbjct: 130 DYYQILGLEKDCTVEDVRKAYRKLSLKVHPDKNKAPGAEDAFKAVSKAFQCLSDAESRKR 189 Query: 556 WEKYGNPD 579 ++ G+ + Sbjct: 190 YDLVGSDE 197 >12_02_1140 + 26411424-26411998,26412491-26412761,26412848-26413405 Length = 467 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/65 (44%), Positives = 43/65 (66%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEARRNWEKY 567 Y++LG+P GA EI+++YR+ ++ HPDK GDE+AF + +AYQ L D R ++ Y Sbjct: 14 YDLLGVPRGADGDEIRRAYRRAAVTHHPDK-GGDEEAFKEVARAYQVLGDPALREVYDVY 72 Query: 568 GNPDG 582 G DG Sbjct: 73 GE-DG 76 >05_03_0564 - 15502458-15503303,15503394-15503474,15503572-15503620, 15503786-15503828,15504576-15504633,15504720-15504858, 15504980-15505107 Length = 447 Score = 59.7 bits (138), Expect = 2e-09 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 2/72 (2%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEARRN 555 D Y LG+ A+++EIK +YRK + HPD K+ G E+ F ++ AY+ L+DDE R Sbjct: 90 DFYSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDPGAEQKFKDISNAYEVLSDDEKRSI 149 Query: 556 WEKYGNPDGPGA 591 ++KYG GA Sbjct: 150 YDKYGEAGLKGA 161 >05_03_0563 - 15493570-15494415,15494506-15494586,15494684-15494732, 15494898-15494940,15495688-15495745,15495832-15495970, 15496092-15496219 Length = 447 Score = 59.7 bits (138), Expect = 2e-09 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 2/72 (2%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEARRN 555 D Y LG+ A+++EIK +YRK + HPD K+ G E+ F ++ AY+ L+DDE R Sbjct: 90 DFYSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDPGAEQKFKDISNAYEVLSDDEKRSI 149 Query: 556 WEKYGNPDGPGA 591 ++KYG GA Sbjct: 150 YDKYGEAGLKGA 161 >05_03_0562 - 15484733-15485578,15485669-15485749,15485847-15485895, 15486061-15486103,15486851-15486908,15486995-15487133, 15487255-15487382 Length = 447 Score = 59.7 bits (138), Expect = 2e-09 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 2/72 (2%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEARRN 555 D Y LG+ A+++EIK +YRK + HPD K+ G E+ F ++ AY+ L+DDE R Sbjct: 90 DFYSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDPGAEQKFKDISNAYEVLSDDEKRSI 149 Query: 556 WEKYGNPDGPGA 591 ++KYG GA Sbjct: 150 YDKYGEAGLKGA 161 >02_01_0717 + 5351504-5351602,5353401-5353499,5353574-5353675, 5353756-5353815,5353900-5354006,5354114-5354196, 5354372-5354462,5354561-5354768 Length = 282 Score = 59.7 bits (138), Expect = 2e-09 Identities = 32/67 (47%), Positives = 42/67 (62%), Gaps = 3/67 (4%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARRNW 558 YEILG+ A+Q EIKK+Y K +L LHPDK GDE+A F +L K L D+E R + Sbjct: 32 YEILGVERTASQQEIKKAYHKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALY 91 Query: 559 EKYGNPD 579 ++ G D Sbjct: 92 DETGIAD 98 >05_04_0027 - 17298727-17299830 Length = 367 Score = 59.3 bits (137), Expect = 2e-09 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 2/67 (2%) Frame = +1 Query: 376 NFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKE--TGDEKAFMRLTKAYQALTDDEAR 549 N D Y ILG+ + EI+K+YRK SL +HPDK G E AF ++KA++ L++D++R Sbjct: 104 NKDYYAILGVERSCSVEEIRKAYRKLSLKVHPDKNKAPGAEDAFKLVSKAFKCLSNDQSR 163 Query: 550 RNWEKYG 570 R +++ G Sbjct: 164 RTYDQTG 170 >08_01_0408 - 3616655-3617108,3617190-3617596,3618120-3618287 Length = 342 Score = 58.0 bits (134), Expect = 6e-09 Identities = 26/68 (38%), Positives = 44/68 (64%), Gaps = 5/68 (7%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK-----AFMRLTKAYQALTDDEA 546 D Y +L + AT+ ++KKSYR+ ++ HPDK GD+K F ++++AY+ L+D + Sbjct: 4 DYYNVLKVNRNATEEDLKKSYRRMAMKWHPDKNPGDKKKEAEAKFKKISEAYEVLSDPQK 63 Query: 547 RRNWEKYG 570 R ++KYG Sbjct: 64 RAIYDKYG 71 >08_02_1300 + 25972496-25972582,25972664-25972723,25973786-25973868, 25974120-25974166,25975194-25975352,25975466-25975644, 25975738-25975818,25975903-25976046,25976246-25976347 Length = 313 Score = 57.6 bits (133), Expect = 8e-09 Identities = 27/64 (42%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARRNW 558 Y++LG+ P AT++EIKK+Y ++ +HPDK D KA F L +AYQ L+D R+ + Sbjct: 8 YDVLGVSPTATESEIKKAYYMKARQVHPDKNPNDPKAAENFQALGEAYQVLSDPTQRQAY 67 Query: 559 EKYG 570 + +G Sbjct: 68 DAHG 71 >02_05_0699 + 31013176-31013345,31013749-31013872,31013950-31014032, 31014106-31014217,31014297-31014401,31014809-31014859, 31015893-31015979,31016325-31016402,31016477-31016530, 31016608-31016892 Length = 382 Score = 57.2 bits (132), Expect = 1e-08 Identities = 27/66 (40%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARR 552 DPYE+LG+ AT+ EIK ++R+ +L HPDK D A F T +Y L+D + RR Sbjct: 31 DPYEVLGVGRNATEQEIKSAFRRMALKYHPDKNADDPVASDKFQEATFSYNILSDPDKRR 90 Query: 553 NWEKYG 570 ++ G Sbjct: 91 QYDSSG 96 >06_01_0929 - 7171395-7171676,7172019-7172219,7172438-7172524, 7172973-7173023,7173883-7173987,7174074-7174185, 7174284-7174366,7174434-7174557,7174822-7174973 Length = 398 Score = 56.0 bits (129), Expect = 2e-08 Identities = 27/66 (40%), Positives = 39/66 (59%), Gaps = 3/66 (4%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARR 552 DPYE+LG+ AT EIK ++R+ +L HPDK D A F +T +Y L+D + RR Sbjct: 25 DPYEVLGVGRNATDQEIKSAFRRMALKYHPDKNGDDPVASDMFQEVTFSYNILSDPDKRR 84 Query: 553 NWEKYG 570 ++ G Sbjct: 85 QYDTSG 90 >06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-927313, 927826-927897,928145-928236,928331-928403,928870-928944, 929207-929314,929372-929422,929834-929959,930324-930362, 930452-930535,931018-931109,931217-931300,931410-931524 Length = 415 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 3/69 (4%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD---EKAFMRLTKAYQALTDDEARR 552 D Y++LG+ A+Q EIKK+Y + LHPD GD E+ F + +AY+ L DD+ R Sbjct: 75 DYYDVLGVSRNASQGEIKKAYYALAKKLHPDTNKGDSDAERKFQEVQRAYETLKDDQKRS 134 Query: 553 NWEKYGNPD 579 +++ G PD Sbjct: 135 LYDQVG-PD 142 >05_01_0207 + 1493224-1493385,1493475-1493839,1494313-1494390, 1496134-1496157,1496213-1496654 Length = 356 Score = 54.8 bits (126), Expect = 5e-08 Identities = 24/66 (36%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKET---GDEKAFMRLTKAYQALTDDEARR 552 D Y++LG+ GAT E+K+SYR+ ++ HPDK D+ F ++++AY L+D + R Sbjct: 4 DYYKVLGVGRGATDEELKRSYRRLAMKHHPDKNRSPHADDSLFKQVSEAYDVLSDPQKRA 63 Query: 553 NWEKYG 570 ++++G Sbjct: 64 IYDQFG 69 >05_07_0111 - 27752339-27752777,27753356-27753840,27753956-27754120 Length = 362 Score = 53.6 bits (123), Expect = 1e-07 Identities = 24/67 (35%), Positives = 44/67 (65%), Gaps = 4/67 (5%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK----AFMRLTKAYQALTDDEAR 549 D Y+ILG+ A+ ++KK+YRK ++ HPDK ++K F ++++AY+ L+D + R Sbjct: 4 DYYKILGVDKAASDDDLKKAYRKLAMKWHPDKNPNNKKEAENKFKQISEAYEVLSDPQKR 63 Query: 550 RNWEKYG 570 +++YG Sbjct: 64 AVYDQYG 70 >05_06_0267 - 26784861-26784896,26785324-26785404,26785530-26785702, 26785780-26785938,26786199-26786328,26786447-26786609, 26787027-26787109,26787605-26787664,26787819-26787940, 26789126-26789275,26789354-26789546,26790156-26790393, 26791240-26791320,26791403-26791647 Length = 637 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 3/69 (4%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARRNW 558 Y+ LG+ A+ AEIKK+Y ++ +HPDK G+ A F L +AYQ L+D R + Sbjct: 322 YDTLGVSVDASPAEIKKAYYLKAKQVHPDKNPGNPDAAQKFQELGEAYQVLSDPSKREAY 381 Query: 559 EKYGNPDGP 585 +K+G P Sbjct: 382 DKHGKEGLP 390 >01_06_0406 + 29113033-29113119,29113250-29113309,29114104-29114186, 29114394-29114556,29114695-29114824,29115016-29115174, 29115295-29115464,29115590-29115670,29116492-29116536, 29116597-29117346,29117424-29117654 Length = 652 Score = 52.0 bits (119), Expect = 4e-07 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 3/69 (4%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD---EKAFMRLTKAYQALTDDEARRNW 558 Y++LG+ A+ AEIKK+Y ++ ++HPDK + E+ F L +AYQ L+D + ++ Sbjct: 8 YDVLGVSTDASAAEIKKAYYLKAKLVHPDKNPNNPDAERRFKELGEAYQILSDPVRKDSY 67 Query: 559 EKYGNPDGP 585 +K+G P Sbjct: 68 DKHGKEGLP 76 >02_04_0220 - 21014225-21014386,21014492-21014572,21014739-21014938, 21014999-21015157,21015248-21015377,21015520-21015673, 21015785-21015867,21015981-21016040,21016131-21016217 Length = 371 Score = 51.6 bits (118), Expect = 5e-07 Identities = 25/64 (39%), Positives = 40/64 (62%), Gaps = 3/64 (4%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARRNW 558 Y++LG+ P A+ EI+K+Y ++ +HPDK D +A F L +AYQ L+D R+ + Sbjct: 8 YDVLGVCPAASDDEIRKAYYIKARQVHPDKNPNDPQAAEKFQALGEAYQVLSDPLQRKAY 67 Query: 559 EKYG 570 + YG Sbjct: 68 DGYG 71 >06_03_1400 + 29901835-29902136,29902913-29902934 Length = 107 Score = 50.8 bits (116), Expect = 9e-07 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDK-ETGDEKAFMRLTKAYQALTDDEARRNW 558 YE+LG+ GA++ EIK +YR+ + +HPD TGDE F+RL AY L D + R + Sbjct: 46 YEVLGVGAGASRGEIKAAYRRLAREVHPDAGATGDED-FIRLHAAYATLADPDERARY 102 >06_03_0949 - 26262993-26263130,26263602-26263670,26263809-26264030 Length = 142 Score = 50.0 bits (114), Expect = 2e-06 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 8/74 (10%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDD--EAR 549 D Y L LPPGAT+ E+K+++R+ +L HPD KE+ F R+ AYQ + + EA Sbjct: 48 DHYRTLRLPPGATKGEVKRAFRRLALTYHPDVSKESDSGVHFQRINVAYQMVMGNMREAE 107 Query: 550 RNWE----KYGNPD 579 E KYG D Sbjct: 108 ERLEYWRLKYGLDD 121 >02_03_0378 + 18327622-18329826 Length = 734 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEARRN 555 D Y IL L A + E+KK YRK +L LHPD K G E AF +++A+ L+D + Sbjct: 72 DWYRILSLSASADEEEVKKQYRKLALQLHPDKNKSVGAEGAFKLISEAWAVLSDKSRKMQ 131 Query: 556 WEK 564 +++ Sbjct: 132 YDQ 134 >12_01_0438 + 3455686-3455692,3456149-3456240,3457422-3457505, 3457598-3457636,3457952-3458041,3458567-3458611, 3458702-3458789,3458902-3458966,3459063-3459137, 3460231-3460303,3460708-3460799,3460896-3460967, 3461165-3461221,3461316-3461364,3461522-3461610 Length = 338 Score = 49.6 bits (113), Expect = 2e-06 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Frame = +1 Query: 370 MSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGD-EKAFMRLTKAYQALTDD 540 M+ D Y++LG+ A+ ++IKK+Y + HPD KE D EK F + AY+ L DD Sbjct: 7 MNARDYYDVLGVNKDASASDIKKAYYLLAKKFHPDTNKEDADAEKKFQEVQHAYEVLKDD 66 Query: 541 EARRNWEKYG 570 + R +++ G Sbjct: 67 DKRETYDQLG 76 >04_03_0735 + 19141038-19143227 Length = 729 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 2/58 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEAR 549 D Y IL L A + E+KK YRK +L LHPD K G E+AF +++A+ L+D+ + Sbjct: 62 DWYRILSLTAFADEEEVKKQYRKLALQLHPDKNKSVGAEEAFKLISEAWSVLSDNSKK 119 >03_02_0205 + 6389343-6389609,6390418-6390486,6390662-6390757, 6391120-6391244,6391331-6391483,6392863-6392992, 6393122-6393282,6393660-6393702,6393869-6394042, 6394471-6394525,6394567-6394746,6396234-6396339, 6396448-6396506,6397419-6397541,6397825-6397919 Length = 611 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Frame = +1 Query: 367 EMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDD 540 E D Y L L AT E+K +YR + HPD K+ G E+ F ++ AY+ L+D+ Sbjct: 58 ERGGKDYYATLNLRRDATLQEVKTAYRTLARKYHPDMNKDPGAEEKFKEISAAYEILSDE 117 Query: 541 EARRNWEKYG 570 E R ++++G Sbjct: 118 EKRSLYDRFG 127 >03_01_0260 - 1999462-1999488,1999748-1999930,2000940-2001146, 2001895-2002359 Length = 293 Score = 48.8 bits (111), Expect = 3e-06 Identities = 29/73 (39%), Positives = 39/73 (53%), Gaps = 8/73 (10%) Frame = +1 Query: 367 EMSNFDPYEILGLPPGATQA-----EIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAY 522 E + D YE+L LP G A +I+K+YR QS + HPDK D A F RL +Y Sbjct: 4 EDDDVDHYEVLCLPSGEEGAGLSLEQIEKAYRTQSRLRHPDKRPDDPNATADFQRLASSY 63 Query: 523 QALTDDEARRNWE 561 L D+ RR ++ Sbjct: 64 NFLRDESLRRQFD 76 >02_05_0821 - 32019775-32019882,32020296-32020352,32020614-32020687, 32021508-32021583,32021796-32021873,32022130-32022228 Length = 163 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 3/66 (4%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARR 552 D Y+IL + A++ I+ SY + +L HPDK+ G+E A F + +AYQ L++ RR Sbjct: 34 DYYKILEVGYDASEEAIRSSYIRLALKWHPDKKQGEENATSRFQEINEAYQVLSNPAKRR 93 Query: 553 NWEKYG 570 ++K G Sbjct: 94 EYDKKG 99 >02_01_0713 - 5332145-5332351,5332675-5332893,5334347-5334559, 5334637-5334730,5334860-5335020,5335114-5335315, 5335619-5335784,5336208-5336286 Length = 446 Score = 48.0 bits (109), Expect = 6e-06 Identities = 24/65 (36%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD----EKAFMRLTKAYQALTDDEAR 549 D Y+ILG+ A+ AEIK++Y+K +L HPDK E F + AY+ L D++ R Sbjct: 327 DWYKILGISKTASAAEIKRAYKKLALQWHPDKNVDKREEAENMFREIAAAYEVLGDEDKR 386 Query: 550 RNWEK 564 +++ Sbjct: 387 VRYDR 391 >01_07_0380 + 43181564-43181639,43182053-43182218,43182494-43182695, 43182789-43182949,43183079-43183172,43183250-43183462, 43184917-43185135,43185458-43185661 Length = 444 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/65 (35%), Positives = 39/65 (60%), Gaps = 4/65 (6%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD----EKAFMRLTKAYQALTDDEAR 549 D Y+ILG+ A+ A+IK++Y+K +L HPDK + E F + AY+ L D++ R Sbjct: 326 DWYKILGISKTASAADIKRAYKKLALQWHPDKNVDNREEAENMFREIAAAYEVLGDEDKR 385 Query: 550 RNWEK 564 +++ Sbjct: 386 VRYDR 390 >08_02_1491 + 27500532-27500972 Length = 146 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPD-KETGDEKAFMRLTKAYQALTDDEARRNWEK 564 Y++LGL GAT EIK +YR+ + HPD + F+RL AY L+D ++R +++ Sbjct: 46 YDVLGLRAGATVREIKAAYRRLARERHPDVAASAGADDFVRLHDAYATLSDPDSRARYDR 105 >03_02_0845 - 11700830-11701327 Length = 165 Score = 46.8 bits (106), Expect = 1e-05 Identities = 25/68 (36%), Positives = 36/68 (52%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEARRNWEKY 567 YE+L + A EIK +YR+ + HPD G + FM +AY+ L+D E RR ++ Sbjct: 56 YEVLAVEETAGAEEIKAAYRRAARRWHPDACPGGAERFMLAREAYEVLSDPERRRGYDIQ 115 Query: 568 GNPDGPGA 591 G GA Sbjct: 116 LRCCGAGA 123 >01_01_0976 + 7711634-7711801,7712741-7713183,7715813-7716251 Length = 349 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 5/68 (7%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK-----AFMRLTKAYQALTDDEA 546 D Y++LG+ GA ++KK+Y K ++ HPDK + K F ++++AY+ L+D + Sbjct: 4 DYYKVLGVDRGAGDDDLKKAYHKLAMRWHPDKNPTNNKKEAEAKFKQISEAYEVLSDPQK 63 Query: 547 RRNWEKYG 570 R +++ G Sbjct: 64 RTIYDQVG 71 >06_03_0339 - 19687749-19690805 Length = 1018 Score = 46.0 bits (104), Expect = 2e-05 Identities = 28/66 (42%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKE--TGDEKAFMRLTKAYQALTDDEARRN 555 D Y IL +P A IKK YRK +L+LHPDK G E AF + +A LTD R Sbjct: 67 DWYGILQVPVTADDTLIKKQYRKLALLLHPDKNNFAGAEAAFKLVGEANMTLTDRSKRSV 126 Query: 556 WEKYGN 573 ++ N Sbjct: 127 YDMKRN 132 >03_02_0438 + 8470290-8470378,8470900-8470990,8471074-8471134, 8471678-8471755,8471891-8471964,8472689-8472802, 8472881-8472988,8473937-8473975,8474046-8474132 Length = 246 Score = 46.0 bits (104), Expect = 2e-05 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 2/58 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEAR 549 +P+E L L ++ E+KK YRK SL++HPD K ++AF L KA Q L D + R Sbjct: 38 NPFEHLKLSFDSSADEVKKQYRKLSLLVHPDKCKHPKAQEAFAALAKAQQLLLDPQER 95 >01_07_0010 + 40429613-40429677,40429702-40430015,40432150-40434386 Length = 871 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 2/63 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKE--TGDEKAFMRLTKAYQALTDDEARRN 555 D Y IL + +IKK YRK +L HPDK +G E AF + A+ L+D + +R+ Sbjct: 193 DLYGILDISASDDDEKIKKQYRKLALQTHPDKNKFSGAESAFKLIQDAWDVLSDKDKKRS 252 Query: 556 WEK 564 +++ Sbjct: 253 YDQ 255 >03_06_0049 + 31282563-31282841,31283052-31283903,31284109-31284194, 31284544-31284678,31285087-31285252 Length = 505 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +1 Query: 361 DYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPD-KETGDEKAFMRLTKAYQALTD 537 D E++ YE+LG+ ++ AEIK S+ + + HPD F+++ AY+ L+D Sbjct: 38 DDELAGKSAYEVLGVGETSSSAEIKASFHRLAKETHPDVAAAAGSSRFLQILAAYEILSD 97 Query: 538 DEARRNWEKY 567 + R +++ Y Sbjct: 98 SQRRAHYDIY 107 >01_05_0646 + 23907837-23907956,23908077-23908164,23908282-23908364, 23908487-23908543,23908694-23908939 Length = 197 Score = 45.2 bits (102), Expect = 4e-05 Identities = 24/61 (39%), Positives = 39/61 (63%), Gaps = 7/61 (11%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD----EKA---FMRLTKAYQALTDDEA 546 Y +LG+ PGA+ AEI+ +Y + ++ HPDK T E+A F ++ +AYQ L+D++ Sbjct: 17 YAVLGVHPGASAAEIRAAYHRLAMKWHPDKITSGRVDAEEAKSRFQQVHEAYQVLSDEKR 76 Query: 547 R 549 R Sbjct: 77 R 77 >02_02_0600 + 12018256-12018502,12018943-12019073,12019104-12019553 Length = 275 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/55 (38%), Positives = 35/55 (63%), Gaps = 4/55 (7%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK----AFMRLTKAYQALT 534 D Y++L + GAT+ E+KK+YRK ++ HPDK +K F ++++AY+ T Sbjct: 4 DYYKLLQVERGATEEELKKAYRKLAMKWHPDKNPNSKKEAEAKFKQISEAYEVTT 58 >01_05_0147 + 18597194-18597643,18598347-18598681,18600073-18600147, 18600325-18600427,18601554-18601642,18602953-18603064, 18604093-18604146,18604271-18604319,18606236-18606347, 18606389-18606436,18607000-18607327 Length = 584 Score = 44.8 bits (101), Expect = 6e-05 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = +1 Query: 385 PYEILGLPPGATQAEIKKSYRKQSLVLHPDK--ETGDEKAFMRLTKAYQALTDDEAR 549 PY+++G+ + IKK Y K SL++HPDK ++AF++L A++ L D E R Sbjct: 333 PYDVVGINWKMSSDNIKKRYWKLSLLVHPDKCPHPSAQEAFVKLNNAFKDLQDPEKR 389 >12_02_1085 - 25935688-25935948,25936589-25936657,25937244-25937315, 25937693-25937791,25937927-25938007,25938099-25938586, 25938728-25938857,25939994-25940239 Length = 481 Score = 44.4 bits (100), Expect = 8e-05 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 5/69 (7%) Frame = +1 Query: 370 MSNFDPYEILGLPPGAT--QAEIKKSYRKQSLVLHPDKETGDE---KAFMRLTKAYQALT 534 M YE+LG+P + Q +KK Y + L++HPDK G+ ++F +L AY+ L+ Sbjct: 259 MDGLTHYEVLGIPRNRSIDQKILKKEYHRMVLLVHPDKNMGNPLACESFKKLQSAYEVLS 318 Query: 535 DDEARRNWE 561 D + ++ Sbjct: 319 DFTKKNTYD 327 >12_02_0454 + 19199063-19200757,19202201-19202287 Length = 593 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 6/66 (9%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKE-TGDE-----KAFMRLTKAYQALTDDEAR 549 YE+LG+P + A+IK ++R+ +L LHPDK+ G + AF L A+ L+D R Sbjct: 12 YEVLGVPRDCSPADIKLAFRRLALSLHPDKQPPGSDVAAATAAFQELQHAHSVLSDPHER 71 Query: 550 RNWEKY 567 ++ + Sbjct: 72 SYYDSH 77 >03_06_0554 + 34691050-34691242,34691327-34691394,34691754-34692275 Length = 260 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/62 (37%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKET--GDEKAFMRLTKAYQALTDDEARRN 555 D Y +L + AT+ +++ YR+ +L LHPDK T E AF +++A+ LTD RR Sbjct: 41 DWYLVLAVADAATEDAVRRRYRQLALQLHPDKNTHAKAEVAFKIVSEAHACLTDGARRRA 100 Query: 556 WE 561 ++ Sbjct: 101 FD 102 >02_05_0381 - 28483425-28483458,28483588-28483658,28483746-28483819, 28483975-28484050,28484129-28484206,28485557-28485589 Length = 121 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARR 552 D Y++L + A+ IK SYR+ +L+ HPDK GD F + +AY L+D R Sbjct: 12 DYYKVLEVDYDASDDTIKLSYRRLALMWHPDKHKGDNDVTAKFQEINEAYTVLSDPAKRL 71 Query: 553 NWEKYG 570 ++ G Sbjct: 72 EYDLSG 77 >06_01_0806 - 6048042-6048138,6048461-6048550,6049362-6049425, 6049504-6049552,6050403-6050459,6050953-6051024, 6051912-6052003,6052542-6052614,6052686-6052748, 6052837-6052901,6053803-6053890,6053974-6054015, 6054097-6054188,6054601-6054688,6055134-6055225, 6055368-6055419 Length = 391 Score = 42.7 bits (96), Expect = 2e-04 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 4/77 (5%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD---EKAFMRLTKAYQALTDDEARR 552 D Y+ILG+P A+Q EIK+++ + HPD G+ ++ F + AY+A + Sbjct: 26 DYYKILGVPKDASQEEIKRAFHSLAKRYHPDTNRGNTAAKRTFQEIRDAYEARFHKQGHN 85 Query: 553 NW-EKYGNPDGPGAMSF 600 + E Y +GP + F Sbjct: 86 PFAEFYRQNNGPFSSKF 102 >03_06_0568 - 34778408-34778710,34779340-34779411,34779549-34779635, 34779722-34779880,34780641-34780739,34780823-34780903, 34781007-34781461,34781550-34781679,34781952-34782743 Length = 725 Score = 42.7 bits (96), Expect = 2e-04 Identities = 17/47 (36%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Frame = +1 Query: 430 IKKSYRKQSLVLHPDKETGDEK---AFMRLTKAYQALTDDEARRNWE 561 +K+ Y+K+++++HPDK G++K AF +L AY+ L D R+ ++ Sbjct: 452 LKREYKKKAMLVHPDKNMGNDKAADAFKKLQNAYEVLLDSLKRKTYD 498 >03_03_0278 - 16126803-16129049 Length = 748 Score = 42.7 bits (96), Expect = 2e-04 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEARRN 555 D Y IL + A +KK YRK L LHPD K G E AF + +A+ L+D R Sbjct: 66 DWYSILSVESSADDETLKKQYRKLVLQLHPDKNKSVGAEGAFKMVQEAWTVLSDKTKRAL 125 Query: 556 WEK 564 +++ Sbjct: 126 YDQ 128 >01_04_0054 - 15456668-15459691 Length = 1007 Score = 42.3 bits (95), Expect = 3e-04 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKE--TGDEKAFMRLTKAYQALTDDEARRN 555 D Y +L + A +A IKK +RK + LHPDK G E AF + +A L+D RR Sbjct: 66 DFYGVLQVDVMADEATIKKQFRKLAFSLHPDKNGFAGAEAAFKLVAEAQSTLSDRTKRRA 125 Query: 556 WE 561 ++ Sbjct: 126 YD 127 >12_01_0915 - 8908643-8908756,8909086-8909203,8909570-8909682, 8911138-8911218,8911307-8911357,8912173-8912232, 8913353-8913419,8913509-8913759 Length = 284 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = +1 Query: 415 ATQAEIKKSYRKQSLVLHPDKETGDE--KAFMRLTKAYQALTDDEARRNWE 561 A +EIKK+Y K SL HPDK E K F+++ AY+ L D+ R ++ Sbjct: 68 ANVSEIKKAYYKLSLKHHPDKNPDPESRKLFVKIANAYEILKDESTRGQYD 118 >11_06_0179 + 20952070-20955228 Length = 1052 Score = 41.9 bits (94), Expect = 4e-04 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKET--GDEKAFMRLTKAYQALTDDEAR 549 D Y IL + A +A I+K YRK + LHPDK + G E AF + +A+ L D R Sbjct: 66 DWYGILQVEATADEATIRKQYRKLAFSLHPDKNSFAGAEAAFKLVAEAHSLLCDPTKR 123 >02_01_0225 - 1469295-1469733,1472352-1472767,1473603-1473658, 1473827-1473995 Length = 359 Score = 41.9 bits (94), Expect = 4e-04 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKE-TGDEKA---FMRLTKAYQALT 534 D Y IL + AT ++KKSYR+ + HPDK TG +A F ++T+AY+A T Sbjct: 4 DYYNILKVNRNATLEDLKKSYRRLARTWHPDKNPTGGAEAEAKFKQITEAYEART 58 >09_04_0594 - 18831011-18831360,18831562-18832111,18832364-18833406, 18833496-18833760,18835194-18835340,18835431-18835511, 18835626-18835804,18835935-18836093,18836269-18836398, 18836935-18837094,18837337-18837419,18837865-18837915, 18838035-18838151,18838273-18838359 Length = 1133 Score = 41.5 bits (93), Expect = 5e-04 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA 498 Y++LG+ P AT+ EIKK+Y ++ +HPDK D A Sbjct: 8 YDVLGVSPTATEVEIKKAYYMKARKVHPDKNPNDPLA 44 >01_01_1212 + 9763949-9764412,9765183-9765252,9765356-9765457 Length = 211 Score = 41.1 bits (92), Expect = 7e-04 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 9/69 (13%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---------FMRLTKAYQALT 534 D Y+ LGL AT+AE+K ++R+++L HPD+ A F + AY+ L+ Sbjct: 4 DHYQTLGLRQDATKAEVKAAFRRRALRDHPDRHAHSPDAAARADAARRFRLASDAYRVLS 63 Query: 535 DDEARRNWE 561 DD R ++ Sbjct: 64 DDRLRAEYD 72 >11_01_0725 - 5987706-5988126,5988610-5988902 Length = 237 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 4/59 (6%) Frame = +1 Query: 397 LGLPPGATQAEIKKSYRKQSLVLHPDKET----GDEKAFMRLTKAYQALTDDEARRNWE 561 LG+ P A EIK +YR+ S HPD + + F+RL +AY L+ +E+RR ++ Sbjct: 100 LGVEPKADIEEIKAAYRRLSKEYHPDTTSLPLREASERFIRLREAYNVLSREESRRFYD 158 >07_03_1296 + 25583195-25584385 Length = 396 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEA 546 DP +L L P AE+K+SYR+ S +L + G + A + +A+ L+D A Sbjct: 71 DPIAVLHLQPNPDPAEVKRSYRRLSNLLSSNPRPGADAALRCVQEAFAHLSDSSA 125 >03_02_0704 - 10542187-10542339,10542466-10542522,10542667-10542737, 10542823-10542901,10543021-10543161 Length = 166 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 4/62 (6%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD----EKAFMRLTKAYQALTDDEARRN 555 Y +LG+ A+ +++ +YR+ ++ HPD+ D + F R+ +AY L+D R Sbjct: 24 YSLLGIRKNASATDVRAAYRRLAMKWHPDRCVSDPGEANRRFQRIQEAYSVLSDKGKRAM 83 Query: 556 WE 561 ++ Sbjct: 84 YD 85 >01_01_1190 + 9463973-9465732,9466210-9466440,9467664-9467793, 9468723-9468888,9469528-9469859,9470284-9470513, 9471535-9471613,9471689-9471865 Length = 1034 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 Y ILG+ P T +IKK+YRK +L HPDK Sbjct: 947 YLILGIEPSCTFLDIKKAYRKAALRHHPDK 976 >01_01_0013 + 81507-81932,82718-82864 Length = 190 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 5/64 (7%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA-----FMRLTKAYQALTDDEARR 552 Y++LG+ T E++ +YR+ + HPD D A F+ + +AY+ L+D R Sbjct: 56 YDLLGISSEGTLDEVRAAYRRMARKYHPDVSPPDAAAENTRRFIEVQEAYETLSDPSRRA 115 Query: 553 NWEK 564 +++ Sbjct: 116 TYDR 119 >08_02_0992 + 23380855-23381195,23382464-23382506,23383306-23383371, 23384228-23384428,23384450-23384707,23384798-23385013, 23385148-23385321,23386151-23386312,23386594-23386635 Length = 500 Score = 37.9 bits (84), Expect = 0.007 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 9/68 (13%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETG---------DEKAFMRLTKAYQALTDD 540 YE+L + GAT E++ YR L HPDK + F + KA++ L D Sbjct: 14 YEVLSVNEGATYDEVRAGYRAAILNAHPDKSQAKLDSLVSSVEHGEFFSVQKAWEVLRDP 73 Query: 541 EARRNWEK 564 ++R ++K Sbjct: 74 KSRTEYDK 81 >08_02_0469 - 17531189-17531678,17531773-17531798,17533511-17533669 Length = 224 Score = 37.5 bits (83), Expect = 0.009 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 4/51 (7%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK-ETGDEKA---FMRLTKAY 522 D YEIL + AT +I+++YR+ ++ HPDK TG + A F +T+AY Sbjct: 2 DYYEILHVDRSATDDDIRRAYRRLAMRWHPDKNHTGKKDAEAKFKDITEAY 52 >04_04_1571 + 34504087-34504421,34505002-34505731,34506091-34512077, 34512493-34513964,34514114-34514377,34514761-34514978, 34515759-34516030,34516190-34516559,34516578-34516797, 34516819-34518931,34518941-34519193,34519269-34519401, 34520597-34521114,34521207-34522115,34522195-34522368, 34522833-34522882,34523963-34524035,34524413-34524477, 34524736-34525522,34525622-34525878,34525989-34526109, 34526315-34526956 Length = 5320 Score = 36.7 bits (81), Expect = 0.015 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = +1 Query: 370 MSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDE 543 ++ +D Y +LG+ + Q+EIK +YR HPD G + A + L + Y L+D Sbjct: 4916 VTEYDLYGLLGVERSSPQSEIKAAYRSLQKRCHPDVAGAKGHDMAIV-LNEVYSLLSDPA 4974 Query: 544 ARRNWEK 564 AR +++ Sbjct: 4975 ARLAYDQ 4981 >01_06_0592 + 30465956-30466210,30466401-30466529,30466631-30466760, 30466861-30466981,30467111-30467192,30467334-30467384, 30467836-30467929,30468046-30468173 Length = 329 Score = 36.3 bits (80), Expect = 0.020 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARR 552 D Y +LG+ P AT +IKK+Y HPD D M + + Y LTD R Sbjct: 78 DYYAVLGVMPDATPQQIKKAYYNCMKACHPDLSGNDPDVTNFCMFINEVYTVLTDPIQRA 137 Query: 553 NWEK 564 +++ Sbjct: 138 VYDE 141 >01_01_1211 + 9753518-9753894,9754265-9754313,9754747-9754773 Length = 150 Score = 35.5 bits (78), Expect = 0.035 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 8/68 (11%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA--------FMRLTKAYQALTD 537 D Y LG+ GA++AE+K ++ + + + HPD+ + A F R+ AY L Sbjct: 8 DYYRTLGIERGASKAEVKAAFYRLAPLHHPDRHAASDAAARAAAGGRFRRVYDAYTVLHS 67 Query: 538 DEARRNWE 561 D R ++ Sbjct: 68 DATRAAYD 75 >06_01_0667 + 4878784-4878900,4879016-4879118,4879256-4879341, 4879434-4879496,4879589-4879831,4880639-4880728, 4881403-4881600 Length = 299 Score = 35.1 bits (77), Expect = 0.046 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 D Y +LGL T A+++ +YRK +++ HPD+ Sbjct: 14 DLYAVLGLSRECTDADLRLAYRKLAMIWHPDR 45 >05_06_0167 - 26104527-26104567,26105130-26105226,26105377-26105415, 26105628-26105678,26105978-26106059,26106222-26106282, 26106380-26106509,26106630-26106758,26107057-26107314 Length = 295 Score = 35.1 bits (77), Expect = 0.046 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAF----MRLTKAYQALTDDEAR 549 D Y +LG+ P AT EIKK+Y HPD +GD M + + Y L+D R Sbjct: 79 DFYSVLGVMPDATPEEIKKAYYSCMKACHPDL-SGDNPEVTNFCMFINEVYTVLSDPVQR 137 Query: 550 RNWEK 564 +++ Sbjct: 138 AVYDE 142 >11_06_0153 - 20693663-20693689,20693808-20694096,20694493-20694829, 20695304-20696516,20700247-20700744 Length = 787 Score = 34.7 bits (76), Expect = 0.061 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKET--GDEKAFMRLTKAYQALTDDEAR 549 D Y +L + A + I+K Y S LHPD T G E AF +++A+ L+D R Sbjct: 66 DWYGVLQVDKMADETVIRKQYNILSYRLHPDNNTLFGAEAAFRFVSEAHAVLSDHAKR 123 >10_08_1023 - 22341815-22342042,22342179-22342247,22342717-22342840, 22343193-22343317,22343815-22344276,22344357-22344700, 22345061-22345406,22345492-22345941,22346760-22347051, 22347171-22347515,22347611-22347834,22348072-22348563, 22348664-22349056,22349601-22349741,22349845-22350207, 22350494-22352683,22353298-22353360,22353434-22353535, 22353672-22354027,22354326-22354413,22354517-22354750, 22355508-22355975 Length = 2632 Score = 34.3 bits (75), Expect = 0.080 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +1 Query: 421 QAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQAL 531 + ++K+ YRK ++ HPDK + F+ + KAY+ L Sbjct: 1593 EEKLKRQYRKLAIKYHPDKNPEGREKFVAVQKAYERL 1629 >09_03_0078 + 12137124-12137672 Length = 182 Score = 34.3 bits (75), Expect = 0.080 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 7/67 (10%) Frame = +1 Query: 382 DPYEILGLP-PGATQAE-IKKSYRKQSLVLHPD-----KETGDEKAFMRLTKAYQALTDD 540 D Y++L L G AE I+++YR+ +L HPD + + F++L +AY+ L+D Sbjct: 54 DYYKVLSLDRAGEVGAEEIRRAYRRLALRYHPDACPPSRRAESTRLFLQLRRAYETLSDP 113 Query: 541 EARRNWE 561 R ++ Sbjct: 114 ALRVRYD 120 >10_08_0580 - 18912364-18912420,18912524-18912631,18912973-18913212, 18913809-18913886,18914063-18914143,18914354-18914407, 18920402-18920545 Length = 253 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 Y +L L P A+ EI+++YR+ + + HPDK Sbjct: 14 YALLHLSPDASGEEIRRAYRQYAQIYHPDK 43 >01_05_0090 + 18038219-18038421,18039365-18039488,18040229-18040311, 18040401-18040473,18040584-18040688,18040803-18040853, 18041705-18041781,18041879-18042037,18043548-18043692, 18043776-18043884,18043959-18044107,18044175-18044258, 18044784-18044825,18045811-18046014 Length = 535 Score = 33.9 bits (74), Expect = 0.11 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 27/90 (30%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSL------------------------VLHPDKETGD 489 DPYE+L +P ++ EIK +YRK +L + HPDK + Sbjct: 18 DPYEVLSVPRDSSDQEIKSAYRKLALKFVLPLTCPPCSCCCFRSRYSDCRMYHPDKNASN 77 Query: 490 EKA---FMRLTKAYQALTDDEARRNWEKYG 570 +A F + +Y L+D E RR ++ G Sbjct: 78 PEASELFKEVAYSYSILSDPEKRRQYDTAG 107 >09_04_0406 + 17340129-17340650 Length = 173 Score = 33.5 bits (73), Expect = 0.14 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 9/68 (13%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDK---------ETGDEKAFMRLTKAYQALTDD 540 YE+L + AT EI+ +Y+ L HPDK + + F+ + KA++ L Sbjct: 14 YEVLSVRKDATYDEIRAAYKSAVLNTHPDKAQMALNPLVSSSERNEFLSVQKAWEILRYP 73 Query: 541 EARRNWEK 564 ++R ++K Sbjct: 74 KSRAEYDK 81 >07_03_1417 + 26418131-26418178,26418410-26418502,26418861-26418891, 26419011-26419037,26419115-26419235,26419320-26419374 Length = 124 Score = 33.1 bits (72), Expect = 0.19 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 7/56 (12%) Frame = +1 Query: 391 EILGLPPGA--TQAEIKKSYRKQSLVLHPDK-----ETGDEKAFMRLTKAYQALTD 537 E+LGLP + +E+K +YR+ + HPD+ ++ E F ++++AY L D Sbjct: 2 ELLGLPAHTRPSPSEVKAAYRRMVMESHPDRVPTHQKSQAESKFKQISEAYSCLKD 57 >03_05_0019 + 19862171-19863049 Length = 292 Score = 33.1 bits (72), Expect = 0.19 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 7/58 (12%) Frame = +1 Query: 382 DPYEILGLPPGATQA-----EIKKSYRKQSLVLHPDKET--GDEKAFMRLTKAYQALT 534 D Y +LGLP + +KK YRK L++HPDK T + AF + A+ L+ Sbjct: 75 DWYAMLGLPQPRSDLVTHHDAVKKQYRKLCLLVHPDKNTSAAADGAFKLVQTAWDVLS 132 >03_06_0601 + 34991912-34992352,34993719-34994516 Length = 412 Score = 32.7 bits (71), Expect = 0.25 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 418 TQAEIKKSYRKQSLVLHPDKET--GDEKAFMRLTKAYQALT 534 T +K+ YR+ LVLHPDK + E AF L +A+ L+ Sbjct: 96 THESLKQQYRRLCLVLHPDKNSSAAAEGAFKLLREAWDKLS 136 >07_03_1340 + 25887135-25887372,25887676-25887798,25888388-25888527, 25888680-25888817,25888898-25889119 Length = 286 Score = 32.3 bits (70), Expect = 0.32 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 9/59 (15%) Frame = +1 Query: 415 ATQAEIKKSYRKQSLVLHPDK-------ETGD--EKAFMRLTKAYQALTDDEARRNWEK 564 A + IK +YR+ + HPD E G+ E F+++ AY+ L DD+ R+++++ Sbjct: 101 ADEETIKTAYRRLAKFYHPDVYDGKGTLEEGETAEARFIKIQAAYELLIDDQRRKSYDR 159 >05_07_0247 + 28643862-28644310,28645151-28645207,28645644-28648950, 28649069-28649144,28649356-28649426,28649524-28649589, 28649677-28649766,28649874-28650050,28650513-28650548 Length = 1442 Score = 32.3 bits (70), Expect = 0.32 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +1 Query: 331 GFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 G L +S Y + ++ + L T A +KK+YRK +L +HPDK Sbjct: 1361 GNLRALLSTLQYILGADSGWQPVPLTELITAAAVKKAYRKATLCVHPDK 1409 >02_05_1130 - 34319558-34319603,34320236-34320335,34320498-34320577, 34320680-34320840,34321602-34321731,34322055-34322230, 34322873-34323068,34323768-34323889,34324376-34324468, 34324672-34324740,34325259-34325423,34325771-34326061 Length = 542 Score = 32.3 bits (70), Expect = 0.32 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 466 HPD--KETGDEKAFMRLTKAYQALTDDEARRNWEKYG 570 HPD KE G F ++ AY+ L+D++ R +++YG Sbjct: 154 HPDVNKEPGATDKFKEISAAYEVLSDEKKRALYDQYG 190 >11_06_0632 + 25674807-25675477,25676472-25677861,25677948-25678083, 25678185-25678282,25678470-25678535,25678699-25678827, 25679570-25679746,25680576-25680614 Length = 901 Score = 31.9 bits (69), Expect = 0.43 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQA-LTDDEARRNWEK 564 ++ + L T A +KK YRK +L +HPDK ++ L + Y A D + W K Sbjct: 838 WQAVSLTDLITGAAVKKQYRKATLCIHPDKV---QQKGANLQQKYTAEKVFDILKEAWNK 894 Query: 565 YGNPD 579 + + + Sbjct: 895 FNSEE 899 >01_03_0254 - 14276308-14276313,14277101-14277277,14278290-14278688 Length = 193 Score = 31.9 bits (69), Expect = 0.43 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 418 TQAEIKKSYRKQSLVLHPDK 477 T A +KK YRK +L +HPDK Sbjct: 151 TAASVKKEYRKATLCIHPDK 170 >08_02_0878 + 22152437-22152532,22152619-22152718,22152907-22152974, 22153085-22153141,22153243-22153350,22153888-22153971 Length = 170 Score = 31.5 bits (68), Expect = 0.57 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 Y +LG+ + A+++ +YRK ++ HPDK Sbjct: 9 YAVLGVASDCSDADLRTAYRKLAMKWHPDK 38 >03_02_0727 - 10742899-10744375,10744470-10744933,10745412-10745477 Length = 668 Score = 31.5 bits (68), Expect = 0.57 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +1 Query: 367 EMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 E N D Y +LG+ G T++E+++++ +L L PD+ Sbjct: 416 EACNIDYYALLGVRRGCTRSELERAHLLLTLKLKPDR 452 >01_05_0808 - 25414486-25414677,25415114-25415290,25415839-25415928, 25416016-25416081,25416170-25416240,25416375-25416450, 25416567-25420098,25421464-25421834 Length = 1524 Score = 31.5 bits (68), Expect = 0.57 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +1 Query: 331 GFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 G L +S Y + + + ++ + L T +KK+YR+ +L +HPDK Sbjct: 1391 GNLRALLSTLQYILGSDNGWQSVPLTDLITATAVKKAYRRATLCVHPDK 1439 >12_02_0693 - 22207582-22207620,22208421-22208597,22209258-22209347, 22210215-22210280,22210473-22210570,22210669-22210789, 22210875-22212477,22213332-22213915 Length = 925 Score = 31.1 bits (67), Expect = 0.75 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = +1 Query: 418 TQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEARRNWEKYGNPD 579 T A +KK YRK +L +HPDK +K K D + W K+ + + Sbjct: 872 TAAAVKKVYRKATLCIHPDKV--QQKGANLQQKYVAEKVFDLLKEAWNKFNSEE 923 >11_08_0055 - 28095996-28096934 Length = 312 Score = 31.1 bits (67), Expect = 0.75 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 70 MGGQKFEYDESGSTFFYFVLSFLALILVPATFYYWPKKRKEDPA 201 M Q+ + F+F+LS LA+ PA YY P+ +++ A Sbjct: 1 MASQRRRSSAATIAVFFFLLSLLAVFFQPAAAYYHPQGKRQTVA 44 >07_03_0325 - 16809700-16809774,16810262-16810316,16810467-16810737, 16810944-16811079,16812261-16812353,16813019-16813063, 16813409-16813543 Length = 269 Score = 31.1 bits (67), Expect = 0.75 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = +1 Query: 427 EIKKSYRKQSLVLHPDKETGDEKA-----FMRLTKAYQALTDDEA 546 ++K +YR +L HPD+ G KA F + AYQ L D A Sbjct: 223 DVKSAYRTCALRWHPDRHNGSTKATAEEKFKHCSAAYQTLCDSLA 267 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 31.1 bits (67), Expect = 0.75 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 412 GATQAEIKKSYRKQSLVLHPDK--ETGDEKAFMRLTKAYQALT 534 G T +K+ Y + LV+HPDK AF L KA+ L+ Sbjct: 88 GVTHESLKRQYHRLCLVVHPDKNRSAAAAGAFRLLQKAWDELS 130 Score = 30.7 bits (66), Expect = 0.99 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 418 TQAEIKKSYRKQSLVLHPDKET--GDEKAFMRLTKAYQALT 534 T +K+ YR+ LVLHPDK + + AF L +A+ L+ Sbjct: 277 THKSLKQQYRRLCLVLHPDKNSSAAADGAFKLLQEAWGELS 317 >08_01_0188 - 1575000-1575062,1575192-1575263,1575371-1575466, 1575856-1575981,1576627-1576684,1577364-1577419, 1577881-1577958,1578051-1578155,1578242-1578347, 1578435-1578556 Length = 293 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD-KETGDEKAFMRLTKAYQAL 531 +PYEILG+ P + +K +Y+++ H + E GD+ +L KAY + Sbjct: 73 NPYEILGITPLDSFDHMKLAYKRK----HKEADENGDQYYLSKLEKAYDTV 119 >10_08_0380 - 17391427-17391435,17392026-17392097,17392215-17392310, 17393355-17393480,17393783-17393840,17394234-17394289, 17394889-17394966,17395053-17395157,17395285-17395393, 17395572-17395705 Length = 280 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEA--RRN 555 +PYEILG+ P ++K +Y+++ +K D + +L +AY + ++ R+N Sbjct: 78 NPYEILGISPLDGFDQVKMAYKRRRKDAESNK---DAEHLFKLERAYDMVMMEQLQNRKN 134 Query: 556 WEKYGN 573 YG+ Sbjct: 135 GVAYGS 140 >10_01_0130 + 1540412-1541173 Length = 253 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK--ETGDEKAFMRLTKAYQALTDDEA 546 D + +LG+ G KK + L+ HPDK + AF +T+A++A++ A Sbjct: 85 DWHTLLGVRRGDGLDAAKKQLKLMRLLTHPDKNRSAAADGAFKLVTEAWEAISSGHA 141 >07_03_1759 + 29285262-29287208 Length = 648 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +1 Query: 367 EMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 E + D Y +LG+ G T++E+++++ +L L PD+ Sbjct: 451 EACSVDYYALLGVRRGCTRSELERAHLLLTLKLRPDR 487 >02_01_0383 + 2776526-2776632,2777579-2777835,2777915-2778366, 2778845-2779102 Length = 357 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/56 (26%), Positives = 29/56 (51%) Frame = +1 Query: 307 IVSGWVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPD 474 +V G + G L K Q ++ DP + L +P ++ ++ S+ ++SL+ H D Sbjct: 10 VVVGGGIAGSLLAKTMQPHADVVLLDPKDYLEIPWAELRSMVEPSFAERSLIYHRD 65 >07_01_0042 - 334417-334431,334563-334688,334852-335136,335220-335368, 336239-336536,337030-337131,337245-337613,337973-338115, 338334-338518,339246-339475,339734-339821,340158-340253, 340397-340512,340604-340852,340950-341175,341411-341622 Length = 962 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 331 GFLAY-KVSQFDYEMSNFDPYEILGLPPGATQAE 429 G LAY S F YEM F PYE PP +AE Sbjct: 403 GDLAYPNPSSFTYEMRFFSPYEYALQPPPWYRAE 436 >03_06_0600 + 34988743-34989407,34990033-34990051 Length = 227 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +1 Query: 418 TQAEIKKSYRKQSLVLHPDKE--TGDEKAFMRLTKAYQALT 534 T ++K Y + L+LHPDK E AF L +A+ L+ Sbjct: 96 THEDLKHQYHRLCLLLHPDKNAAAAAEGAFKLLREAWDNLS 136 >03_02_0030 + 5129234-5129568,5130020-5130651,5130936-5131243, 5131396-5131504,5131871-5131956,5132173-5132232, 5133164-5133340,5133742-5133780 Length = 581 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 373 SNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 S + P ++ + GA +KK+Y+K L LHPDK Sbjct: 516 SGWKPVPLVDIIEGAA---VKKAYQKALLCLHPDK 547 >06_03_0151 + 17270688-17270698,17271149-17271281,17271548-17271589, 17271706-17271815,17271957-17272035,17272114-17272287, 17272386-17272466,17272761-17272988,17273067-17273402, 17273501-17273586,17273642-17273783,17274596-17274687, 17274770-17274904,17275142-17275304,17275393-17275482, 17275568-17275753,17276109-17276141,17276700-17276762, 17276839-17276901,17276983-17277042,17277258-17277410, 17277530-17277613,17278434-17278610,17278685-17278791, 17278858-17279071,17279158-17279261,17279926-17280061, 17280191-17280316,17280682-17280792,17280968-17281066, 17281367-17281633,17281707-17281822,17281853-17282084, 17282597-17282664,17282682-17282807,17282980-17283040 Length = 1495 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRK 450 D Y++LG+ +T EIK++YRK Sbjct: 1440 DYYQVLGVTVNSTPQEIKEAYRK 1462 >09_04_0165 + 15274448-15277336 Length = 962 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 240 QTTNHRTIAALQKREKFLCETCYSIWMGATWIS 338 + T IAALQ+ E FL +S+WM T ++ Sbjct: 926 RVTYTNLIAALQRNENFLEAVKWSLWMKQTGVA 958 >09_03_0148 + 12770010-12770266,12772172-12772314,12773214-12773596, 12773895-12773971,12774061-12774211 Length = 336 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIK--KSYRKQSLVLHPDKETGDEKAFMR-LTKAYQ 525 DPY++LG+ A + EI+ +++ Q H E E A+ + + K+YQ Sbjct: 146 DPYKLLGVDRDAAEEEIRSARNFLIQQYAGHEPSEEAIEGAYEKIIMKSYQ 196 >01_05_0633 + 23840427-23840562,23840699-23840768,23840846-23840951, 23841086-23841184,23841320-23841442,23841555-23842691 Length = 556 Score = 27.9 bits (59), Expect = 7.0 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 4/71 (5%) Frame = +1 Query: 391 EILGLPP-GATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQ---ALTDDEARRNW 558 +IL LPP GA Q + + S+ L D+ +++ Y+ + D AR Sbjct: 97 DILNLPPKGAWQPSLNIATVLTSIGLLLSDPNPDDGLMAEISREYKYNRQVFDINARSWT 156 Query: 559 EKYGNPDGPGA 591 EKY NP GA Sbjct: 157 EKYANPSAIGA 167 >10_08_0184 - 15570471-15570684,15571085-15571354,15571489-15571711, 15571809-15571875,15571996-15572137,15572226-15572290 Length = 326 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 132 ISCINISTSYILLLA*KTKRRSCKISR 212 I+ NI +Y+LLL+ TK +SC R Sbjct: 241 ITAANILLNYVLLLSRNTKSKSCPFCR 267 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,428,966 Number of Sequences: 37544 Number of extensions: 324609 Number of successful extensions: 858 Number of sequences better than 10.0: 103 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 836 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -