BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d17f (627 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 128 3e-30 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 64 9e-11 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 62 3e-10 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 62 5e-10 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 60 1e-09 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 60 1e-09 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 58 8e-09 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 57 1e-08 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 56 3e-08 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 54 1e-07 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 52 5e-07 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 50 2e-06 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 49 3e-06 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 48 5e-06 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 48 6e-06 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 48 8e-06 SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) 47 1e-05 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 46 2e-05 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) 40 0.002 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 38 0.009 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) 32 0.33 SB_24982| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_52096| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_11077| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 29 4.1 SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 9.4 SB_21236| Best HMM Match : Toxin_8 (HMM E-Value=10) 27 9.4 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_2148| Best HMM Match : WSC (HMM E-Value=0.039) 27 9.4 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 128 bits (310), Expect = 3e-30 Identities = 62/123 (50%), Positives = 83/123 (67%), Gaps = 16/123 (13%) Frame = +1 Query: 307 IVSGWVLLGFLAYKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETG 486 IV W++ AYK+SQFD + + +DPY +L + GA+ AEI++ YR S HPDKETG Sbjct: 1223 IVILWIVFFAGAYKISQFDRDFAEYDPYAVLEIDRGASVAEIRRQYRSLSKKYHPDKETG 1282 Query: 487 DEKAFMRLTKAYQA----------------LTDDEARRNWEKYGNPDGPGAMSFGIALPS 618 D + FMR+ KAY+A LT++E+R+NWE++GNPDGPGA SFGIALPS Sbjct: 1283 DPRKFMRIAKAYEAVSDFNKVDYCTDDHFRLTNEESRKNWEEHGNPDGPGATSFGIALPS 1342 Query: 619 WIV 627 W+V Sbjct: 1343 WLV 1345 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 64.1 bits (149), Expect = 9e-11 Identities = 29/67 (43%), Positives = 47/67 (70%), Gaps = 4/67 (5%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD----EKAFMRLTKAYQALTDDEAR 549 D YE+LG+P A++ ++KK+YR+Q+L HPDK + E+ F +L++AY+ L+D E R Sbjct: 4 DYYEVLGVPRSASEEDVKKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKR 63 Query: 550 RNWEKYG 570 ++KYG Sbjct: 64 DIYDKYG 70 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 63.7 bits (148), Expect = 1e-10 Identities = 27/61 (44%), Positives = 43/61 (70%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEARRNWEKY 567 Y+IL +PP AT EIKKSYRK +L HPDK + F ++++AY+ L+D++ R+ +++ Sbjct: 67 YDILNVPPTATATEIKKSYRKLALKYHPDKNPDEGDRFKQISQAYEVLSDEKKRKIYDEG 126 Query: 568 G 570 G Sbjct: 127 G 127 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 62.5 bits (145), Expect = 3e-10 Identities = 28/63 (44%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEARRNWE 561 Y ILG+P A+ +IKK+YR+Q+L+ HPD K +G E+ F +++AY+ LTD R ++ Sbjct: 6 YAILGVPRNASDDDIKKAYRRQALIFHPDKNKNSGAEEKFKEISEAYKVLTDPRQRDIFD 65 Query: 562 KYG 570 YG Sbjct: 66 MYG 68 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 62.1 bits (144), Expect = 4e-10 Identities = 29/72 (40%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEARRN 555 D Y+ILG+PP A Q EIKK+Y + + HPD K+ + F +++AY+ L+DD R+ Sbjct: 59 DYYKILGVPPNANQKEIKKAYFELAKKYHPDTNKDKSASEKFQEVSEAYEVLSDDGKRKA 118 Query: 556 WEKYGNPDGPGA 591 ++ +G D GA Sbjct: 119 YDSFGQTDFSGA 130 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 61.7 bits (143), Expect = 5e-10 Identities = 26/65 (40%), Positives = 44/65 (67%), Gaps = 2/65 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD--EKAFMRLTKAYQALTDDEARRN 555 D Y+ILG+P A+ +IKK++RK ++ HPDK G E+ F + +AY+ L+D+ RR Sbjct: 26 DYYQILGVPRNASDKQIKKAFRKMAVKYHPDKNKGKDAEEKFREVAEAYEVLSDENKRRQ 85 Query: 556 WEKYG 570 ++++G Sbjct: 86 YDQFG 90 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 60.1 bits (139), Expect = 1e-09 Identities = 26/61 (42%), Positives = 40/61 (65%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEARRNWEKY 567 Y++LG+P A+ +IKK+YRK + LHPDK + F +T AY+ L+D E R +++Y Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGEKFKDITFAYEILSDPEKRELYDRY 66 Query: 568 G 570 G Sbjct: 67 G 67 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 60.1 bits (139), Expect = 1e-09 Identities = 26/61 (42%), Positives = 40/61 (65%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEARRNWEKY 567 Y++LG+P A+ +IKK+YRK + LHPDK + F +T AY+ L+D E R +++Y Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGEKFKDITFAYEILSDPEKRELYDRY 66 Query: 568 G 570 G Sbjct: 67 G 67 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/64 (39%), Positives = 41/64 (64%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDEARRNWEKY 567 YE+LG+ AT +I+++YR+ +L HPDK G E+ F +++AY+ L D + R ++K Sbjct: 6 YEVLGVERNATTDDIRRAYRRLALKYHPDKNAGTEENFKEVSEAYEVLCDPQQRERFDKK 65 Query: 568 GNPD 579 PD Sbjct: 66 FAPD 69 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 58.0 bits (134), Expect = 6e-09 Identities = 25/63 (39%), Positives = 42/63 (66%), Gaps = 2/63 (3%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEARRNWE 561 Y+ILG+ A+ E+KK+Y+KQ+ HPD K+ G E+ F + +AY+ L+D + R ++ Sbjct: 6 YDILGVKKDASDQELKKAYKKQAFKYHPDKNKDPGAEEKFKEIAEAYEVLSDPQKREIFD 65 Query: 562 KYG 570 +YG Sbjct: 66 QYG 68 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 57.6 bits (133), Expect = 8e-09 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK--ETGDEKAFMRLTKAYQALTDDEARRN 555 D Y+ILGL AT A+IKK YRK SL HPDK E E F + +AY L+D + R Sbjct: 4 DYYDILGLTRSATDADIKKEYRKLSLKYHPDKNQEPSAEVKFRQAAEAYDVLSDPKKRAI 63 Query: 556 WEKYG 570 + ++G Sbjct: 64 YNQFG 68 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 57.2 bits (132), Expect = 1e-08 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEARR 552 D Y ILG+P A++ +IK++YRK ++ LHPDK D KA F + AY+ L DD+ R+ Sbjct: 25 DFYAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDDPKAQEKFHDIGAAYEVLADDDQRK 84 Query: 553 NWEKYG 570 +++ G Sbjct: 85 IYDQRG 90 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 55.6 bits (128), Expect = 3e-08 Identities = 25/65 (38%), Positives = 42/65 (64%), Gaps = 2/65 (3%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPD--KETGDEKAFMRLTKAYQALTDDEARRN 555 D Y +L + A+ +IKK+YRKQ+L HPD K G E+ F +++AY+ L+D + + Sbjct: 4 DYYAVLNVDKAASADDIKKAYRKQALKYHPDKNKSPGAEEKFKEISEAYEVLSDPKKKEI 63 Query: 556 WEKYG 570 +++YG Sbjct: 64 YDQYG 68 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 53.6 bits (123), Expect = 1e-07 Identities = 36/102 (35%), Positives = 58/102 (56%), Gaps = 7/102 (6%) Frame = +1 Query: 295 VKLAIVSGWVLL-GFLAYKVSQFDY-EMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLH 468 V +VSG+V + + + + FD E + Y++LG+ ATQAEI+++YR+ SL LH Sbjct: 2452 VLFILVSGFVCVHAWDSVDLELFDIVEEVKDNFYQVLGVETTATQAEIRRAYRRISLQLH 2511 Query: 469 PD--KETGDEKAFMRLTKAYQALTDDEARRNWE---KYGNPD 579 PD KE E F +L + L D++ R+ ++ + G PD Sbjct: 2512 PDRNKEDDAELKFRKLVAVAEVLKDEDKRKRYDTILRDGMPD 2553 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 52.4 bits (120), Expect = 3e-07 Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 5/69 (7%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDK-ETGD-EKA---FMRLTKAYQALTDDEARR 552 Y++LG+ A+++EIK++YRK SL +HPD+ + G+ EKA F L+K+Y L+D E R Sbjct: 17 YDVLGVSKTASESEIKRAYRKISLQVHPDRADKGEKEKATRKFQALSKSYCILSDKEKRA 76 Query: 553 NWEKYGNPD 579 +++ G D Sbjct: 77 IYDESGEID 85 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 51.6 bits (118), Expect = 5e-07 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKA---FMRLTKAYQALTDDEAR 549 Y+ LG+ +T+ EI K+YRK++L HPDK + KA F +L+KA + LTD +AR Sbjct: 9 YDTLGVHKDSTEKEILKAYRKKALKCHPDKNPDNPKASELFHKLSKALEVLTDPKAR 65 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/62 (35%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK---AFMRLTKAYQALTDDEARRNW 558 Y +LG+ P A+Q++IK +Y K S+ HPD+ G +K F + +AY L + E+R+ + Sbjct: 74 YNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKKHEVFQEIAEAYSVLGNLESRKQY 133 Query: 559 EK 564 ++ Sbjct: 134 DR 135 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/62 (35%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK---AFMRLTKAYQALTDDEARRNW 558 Y +LG+ P A+Q++IK +Y K S+ HPD+ G +K F + +AY L + E+R+ + Sbjct: 74 YNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKKHEVFQEIAEAYSVLGNLESRKQY 133 Query: 559 EK 564 ++ Sbjct: 134 DR 135 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 4/56 (7%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD----EKAFMRLTKAYQALTD 537 D Y+IL +P A++ +IKKSYRK +L HPDK + E+ F +++AY+ L+D Sbjct: 3 DYYDILEVPRSASEQDIKKSYRKLALKWHPDKNPQNKEEAERKFKEISEAYEVLSD 58 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 49.2 bits (112), Expect = 3e-06 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 5/83 (6%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD-----EKAFMRLTKAYQALTDDEA 546 D Y+ILGL + EI K+YRK ++ HPD G+ EK F+ + A + LTD E Sbjct: 208 DYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGEDKKKAEKMFIDIAAAKEVLTDPEK 267 Query: 547 RRNWEKYGNPDGPGAMSFGIALP 615 R ++ +P P + G P Sbjct: 268 RAKYDAGEDPLDPESQQGGGGWP 290 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 48.4 bits (110), Expect = 5e-06 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDE--KAFMRLTKAYQALTDDEARRNWE 561 Y+++ L P ATQ EIK +Y + S + HPD + E + F LT AY L+ E RR ++ Sbjct: 53 YDVMKLLPTATQREIKSAYYELSRIYHPDLNSSAEARERFAELTLAYNTLSRLETRREYD 112 Query: 562 K 564 K Sbjct: 113 K 113 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 48.4 bits (110), Expect = 5e-06 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDE--KAFMRLTKAYQALTDDEARRNWE 561 Y+++ L P ATQ EIK +Y + S + HPD + E + F LT AY L+ E RR ++ Sbjct: 200 YDVMKLLPTATQREIKSAYYELSRIYHPDLNSSAEARERFAELTLAYNTLSRLETRREYD 259 Query: 562 K 564 K Sbjct: 260 K 260 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 48.0 bits (109), Expect = 6e-06 Identities = 18/32 (56%), Positives = 26/32 (81%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 DPY ILG+PP A+ +IK+ YRK ++++HPDK Sbjct: 800 DPYSILGVPPEASDDDIKRQYRKLAVLIHPDK 831 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 47.6 bits (108), Expect = 8e-06 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 8/68 (11%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETG--------DEKAFMRLTKAYQALTD 537 D Y+IL + A++ EIKK+Y+K++L HPD+ +G EK F + +AY L+D Sbjct: 159 DYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSD 218 Query: 538 DEARRNWE 561 + +R ++ Sbjct: 219 PKKKRRYD 226 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 47.6 bits (108), Expect = 8e-06 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 8/68 (11%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETG--------DEKAFMRLTKAYQALTD 537 D Y+IL + A++ EIKK+Y+K++L HPD+ +G EK F + +AY L+D Sbjct: 159 DYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSD 218 Query: 538 DEARRNWE 561 + +R ++ Sbjct: 219 PKKKRRYD 226 >SB_13154| Best HMM Match : DnaJ (HMM E-Value=7.9e-11) Length = 340 Score = 46.8 bits (106), Expect = 1e-05 Identities = 24/72 (33%), Positives = 33/72 (45%) Frame = +1 Query: 364 YEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEKAFMRLTKAYQALTDDE 543 YE+ D L + +KK+ RKQ L+ HPDK GD + + AY L DDE Sbjct: 133 YEILGLDMKTARKLSKDELKKTLKKACRKQLLIWHPDKNGGDAEQARNIIMAYSCLEDDE 192 Query: 544 ARRNWEKYGNPD 579 R + + D Sbjct: 193 TRARYNNQADYD 204 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD----EKAFMRLTKAYQALTDDEARR 552 Y +LGL ATQ EIKK Y+K ++ HPD+ + +K FM + +AY+ L+ + +R Sbjct: 796 YRVLGLTEDATQEEIKKRYKKLAMKWHPDRHRDNKEEAQKHFMEIQEAYEILSKLKTKR 854 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 3/61 (4%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD---EKAFMRLTKAYQALTDDEARRNW 558 YEIL +P A+Q EIK ++ K++ HPD D KAF+++++AY L+ R+ + Sbjct: 10 YEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSSSARRQQY 69 Query: 559 E 561 + Sbjct: 70 D 70 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 3/61 (4%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGD---EKAFMRLTKAYQALTDDEARRNW 558 YEIL +P A+Q EIK ++ K++ HPD D KAF+++++AY L+ R+ + Sbjct: 71 YEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSSSARRQQY 130 Query: 559 E 561 + Sbjct: 131 D 131 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 4/64 (6%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDK--ETGDE--KAFMRLTKAYQALTDDEARRN 555 YE+LG+ + +KK+YRK +L HPDK + +E + F + +AY L+D + R Sbjct: 6 YEVLGVERDVDDSALKKTYRKLALKWHPDKNLDNAEESTRVFREIQQAYDVLSDPQERAF 65 Query: 556 WEKY 567 ++K+ Sbjct: 66 YDKH 69 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/46 (43%), Positives = 32/46 (69%), Gaps = 2/46 (4%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDKET--GDEKAFMRLT 513 D YE LG+ GAT+ +I ++Y+K ++++HPDK G E+AF L+ Sbjct: 143 DHYERLGIQQGATKDDINRAYKKLAVLIHPDKSVAPGSEEAFKALS 188 >SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) Length = 29 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = +1 Query: 394 ILGLPPGATQAEIKKSYRKQSLVLHPDK 477 ILG+PP A+ +IK+ YRK ++++HPDK Sbjct: 2 ILGVPPEASDDDIKRQYRKLAVLIHPDK 29 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 D YE+ G+ AT EI+K+++K +L LHPDK Sbjct: 28 DYYELFGISRDATSKEIRKAFKKLALRLHPDK 59 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 37.5 bits (83), Expect = 0.009 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 3/78 (3%) Frame = +1 Query: 343 YKVSQFDYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDK---ETGDEKAFMRLT 513 +K+ E+ +F Y +L AT +I ++K++ HPDK +T + F RL Sbjct: 277 FKIVTKTEELEDF--YSLLDCGEYATNEQINTEFKKKAKEWHPDKKRNDTDSHEYFARLK 334 Query: 514 KAYQALTDDEARRNWEKY 567 KA L D++ R ++ + Sbjct: 335 KARDVLCDEKMRAKYDHW 352 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 361 DYEMSNFDPYEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDEK 495 D D Y +L + A + E+K +YR+ ++ HPDK T EK Sbjct: 124 DESEDEVDYYAVLAVRKEANEDELKAAYRRLCVLYHPDKHTDPEK 168 >SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) Length = 118 Score = 32.3 bits (70), Expect = 0.33 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDE 492 Y+++ L P AT EIK +Y + S + HPD + E Sbjct: 77 YDVMKLLPTATLREIKSAYYELSRIYHPDLNSSAE 111 >SB_24982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 32.3 bits (70), Expect = 0.33 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +1 Query: 427 EIKKSYRKQSLVLHPDKETGD 489 ++KK+YRK L +HPDK TG+ Sbjct: 484 DVKKAYRKAVLCVHPDKLTGE 504 >SB_52096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 997 Score = 31.5 bits (68), Expect = 0.58 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 460 VLHPDKE-TGDEKAFMRLTKAYQALTDDEARRNW 558 VL+P + GDE MR A+++DE RRNW Sbjct: 947 VLNPGEAGPGDELTTMRRAYGLSAMSEDEGRRNW 980 >SB_11077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 31.5 bits (68), Expect = 0.58 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +1 Query: 460 VLHPDKE-TGDEKAFMRLTKAYQALTDDEARRNW 558 VL+P + GDE MR A+++DE RRNW Sbjct: 45 VLNPGEAGPGDELTTMRRAYGLSAMSEDEGRRNW 78 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 382 DPYEILGLPPGATQAEIKKSYRKQSLVLHPDK 477 D +LG+ P IK++YRK HPDK Sbjct: 75 DACNVLGVKPTDDATTIKRAYRKLMSEHHPDK 106 >SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 448 KQSLVLHPDKETGDEKAFMRLTKAYQALTDDEARRNWEKYGNPD 579 KQ+L +H +E+ K +A D A+ EKYG PD Sbjct: 795 KQNLEIHKKMSMTEEQREEYERKEREAKYRDRAKERREKYGQPD 838 >SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1219 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +2 Query: 317 DGCYLDF--WHTRSHSLIMRCQTLIRMKFWAYLLVQ 418 DG +LD+ W HSL RC + K +++ +Q Sbjct: 91 DGHFLDWYKWKESIHSLACRCSAAAKKKGYSFFAIQ 126 >SB_21236| Best HMM Match : Toxin_8 (HMM E-Value=10) Length = 173 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 388 YEILGLPPGATQAEIKKSYRKQSLVLHPDKETGDE 492 YE P ++ ++ Y++ L LHP KET +E Sbjct: 139 YEKFESRPQTSRKPVENLYQRYILTLHPCKETNNE 173 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 27.5 bits (58), Expect = 9.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 502 MRLTKAYQALTDDEARRNWEKYGN 573 ++ T AY A+ +DE NWE + + Sbjct: 198 LQATNAYSAMLEDEQPNNWETFAH 221 >SB_2148| Best HMM Match : WSC (HMM E-Value=0.039) Length = 159 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +2 Query: 317 DGCYLDF--WHTRSHSLIMRCQTLIRMKFWAYLLVQ 418 DG +LD+ W HSL RC + K +++ +Q Sbjct: 54 DGHFLDWYKWKESIHSLACRCSAAAKKKGYSFFAIQ 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,434,642 Number of Sequences: 59808 Number of extensions: 399393 Number of successful extensions: 944 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -