BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d16r (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 9.3 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 9.3 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 9.3 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 9.3 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -1 Query: 446 CSRTIERTRARSFWEHFLPCHQLPTSF 366 C R E RS + FL C L +F Sbjct: 26 CRRDAEIQELRSHLDKFLQCASLKLAF 52 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 9.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 320 RRYGEGRPDVLYKFIGRRWAVDDRVGSVPRKNGPESVRSS 439 RR+ EG P + K+I R A+ + + P E V SS Sbjct: 444 RRFVEGYPHAVPKYIQRLKAIRATLKASPFFASHEVVGSS 483 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.4 bits (43), Expect = 9.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 320 RRYGEGRPDVLYKFIGRRWAVDDRVGSVPRKNGPESVRSS 439 RR+ EG P + K+I R A+ + + P E V SS Sbjct: 359 RRFVEGYPHAVPKYIQRLKAIRATLKASPFFASHEVVGSS 398 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 9.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 320 RRYGEGRPDVLYKFIGRRWAVDDRVGSVPRKNGPESVRSS 439 RR+ EG P + K+I R A+ + + P E V SS Sbjct: 678 RRFVEGYPHAVPKYIQRLKAIRATLKASPFFASHEVVGSS 717 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,271 Number of Sequences: 438 Number of extensions: 4998 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -