BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fner10d16f (602 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 2.6 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 3.5 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 8.0 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +2 Query: 443 SYPVINCPPPSDKLVQDIWSSLSVPSGLGCATVIYP 550 SY PP + + D ++S++ P+ T +YP Sbjct: 289 SYAPERYPPLAQGVNDDAFNSVATPTPTSVMTELYP 324 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.2 bits (45), Expect = 3.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 425 VLSGNTSYPVINCPPPSDKLVQDIWSSLSVPS 520 V +G+TS P I ++ IWS S+ S Sbjct: 195 VSTGSTSSPTIASATYTNSANSSIWSPASIDS 226 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 470 PSDKLVQDIWSSLSVP 517 PSDK + IW++ S P Sbjct: 437 PSDKYIIQIWTTGSDP 452 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,201 Number of Sequences: 336 Number of extensions: 3648 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -